(data stored in ACNUC30630 zone)

EMBL: CP002344.PE449

CP002344.PE449       Location/Qualifiers
FT   CDS_pept        534538..535185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0453"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COGs: COG0789 transcriptional regulator protein;
FT                   InterPro IPR000551; KEGG: aac:Aaci_1572 transcriptional
FT                   regulator, MerR family; PFAM: regulatory protein MerR;
FT                   SMART: regulatory protein MerR; SPTR: Transcriptional
FT                   regulator, MerR family; PFAM: MerR family regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50574"
FT                   /db_xref="GOA:E6SGM8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGM8"
FT                   /protein_id="ADU50574.1"
FT                   /translation="MSRHRNLPLYSIGAVSNLTGLSERRIRYYEQAGLVRPARTAGNQR
FT                   RYSQADVERLLEIKGLLQQGLHLDDIRRRLLERRRREAIMGPPDVPVALAAVAADPWPL
FT                   PVSGRGGRGAEPGLPRIDRLFRGPAPAVPGVGTARTLYPALDPAVLYQARRHQRPRDGR
FT                   PWDRLPRPGRDARDARDGKEGGAGGDGLRSPQGPGRRGTPGEGAGHDGPAAG"
     gtgtcccggc accgcaacct acccctctat tccatcggcg ccgtgtccaa cctgacgggc        60
     ctgagcgagc gccgcatccg ctactacgag caggcgggcc tggtgcgccc ggcccggacg       120
     gcgggcaacc agcggcgcta cagccaggcc gacgtcgagc gactgctgga gatcaagggg       180
     ttgttgcagc aggggctcca cctggacgac atccgccgcc gcctgctgga gcgccgccgc       240
     cgggaagcga tcatgggccc gcctgacgta ccggtcgccc tggcggccgt cgccgccgat       300
     ccgtggccgc tccccgtgtc gggccgcggg gggcggggag ccgaacccgg cctgccccgg       360
     atcgaccggc tcttccgcgg ccccgcaccc gcggtacccg gcgtcggcac ggcgcgcacc       420
     ctgtatccgg ccctggatcc ggccgtgctc taccaggccc gccgccacca gcggccgcgg       480
     gacgggcggc cgtgggaccg gttgccgcgg cccggccggg atgcccggga cgccagggac       540
     ggcaaggagg gcggggccgg cggggacggg ctgcgctcgc cccagggacc cggccggcgg       600
     ggcacgccgg gagagggggc ggggcacgat gggccggccg ccggctga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page