(data stored in ACNUC30630 zone)

EMBL: CP002344.PE456

CP002344.PE456       Location/Qualifiers
FT   CDS_pept        542310..542783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0460"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG0824 thioesterase; InterPro IPR006684:
FT                   IPR006683; KEGG: tte:TTE1814 thioesterase; PFAM:
FT                   thioesterase superfamily protein; SPTR: Predicted
FT                   thioesterase; PFAM: Thioesterase superfamily; TIGRFAM:
FT                   acyl-CoA thioester hydrolase, YbgC/YbaW family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50581"
FT                   /db_xref="GOA:E6SGN5"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGN5"
FT                   /protein_id="ADU50581.1"
FT                   /translation="MTCCTLRFRVRYGETDRMGRAYYARYFDWFTDGRTELIRRMGLSY
FT                   RQMEDQGVFLPVLEATCRYLRPVDYDDDLELEVRLQRLTPTRMDFAYRLRTAGGGPAVA
FT                   EGETRHAFIDGRGKPVNLRKARPELWRQLEVLQPEGQALAGREAPLPQEEPAR"
     gtgacctgct gcaccttgcg cttccgggtg cgctacggcg agacggaccg catgggccgg        60
     gcgtattatg cccgttactt cgactggttc accgacgggc ggaccgagct gattcgccgc       120
     atggggctct cgtaccgcca gatggaggac cagggcgtgt tcctcccggt gctggaggcc       180
     acctgccgct accttcgccc cgtggactat gacgacgacc tggagctgga agtccggttg       240
     cagcggctga ctcccacccg catggacttc gcgtaccgcc tgcggacggc cggcggcggt       300
     ccggccgtgg cggaagggga gacccgtcac gccttcatcg acgggcgggg caagcccgtc       360
     aacctgcgca aggcgcggcc ggagctgtgg cggcagttgg aggtcctgca gccggaaggg       420
     caagcgctgg cggggcggga ggcaccgctg ccgcaggagg aaccggcccg gtga             474
//

If you have problems or comments...

PBIL Back to PBIL home page