(data stored in ACNUC30630 zone)

EMBL: CP002344.PE460

CP002344.PE460       Location/Qualifiers
FT   CDS_pept        546423..547415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0464"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /EC_number="3.1.3.11"
FT                   /note="COGs: COG1494 Fructose-1
FT                   6-bisphosphatase/sedoheptulose 1 7-bisphosphatase and
FT                   related protein; InterPro IPR004464; KEGG: chy:CHY_0787
FT                   fructose 1,6-bisphosphatase II; PFAM: GlpX family protein;
FT                   PRIAM: Fructose-bisphosphatase; SPTR:
FT                   Fructose-1,6-bisphosphatase, class II; TIGRFAM:
FT                   fructose-1,6-bisphosphatase, class II; PFAM: Bacterial
FT                   fructose-1,6-bisphosphatase, glpX-encoded; TIGRFAM:
FT                   fructose-1,6-bisphosphatase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50585"
FT                   /db_xref="GOA:E6SGN9"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGN9"
FT                   /protein_id="ADU50585.1"
FT                   /translation="MERELTLELVRVTEAAALAAARWMGRGDKNAADGAAVDAMRAVFD
FT                   TVDIRGTVVIGEGEMDEAPMLYIGEQVGSGQGPEVDVAVDPLEGTNLVAKGLPGAIAVL
FT                   AVAPRGCLLHAPDMYMEKIAVGPAAAGTIDIERPIEENLQAVARALNKRVQDVTVILLD
FT                   RPRHADLVARIRRAGARIRMISDGDVSAAIATALEGTGIDLMVGIGGAPEGVLAAAALY
FT                   CLGGELQGRLWPEDDEDRERMRAMGIDEARVLRIEDLVRGEDVIFAATGITSGEMLKGV
FT                   QFTSRGAFTHSVAMRYRTGTVRFVEAWHRLERKPVIGPLVGGTGPGAAG"
     atggaacggg aactgaccct cgagctggtg cgggtgacgg aggccgccgc cctggcggcc        60
     gcccgctgga tgggccgcgg cgacaagaac gccgccgacg gcgccgccgt cgatgccatg       120
     cgggccgtgt tcgacaccgt ggacatccgc ggcacggtgg tcatcggcga gggcgagatg       180
     gacgaggcgc cgatgctcta catcggcgag caggtgggca gcggccaggg gccggaggtg       240
     gacgtggccg tcgaccccct ggagggcacc aacctggtgg ccaagggcct gcccggggcc       300
     atcgccgtcc tcgccgtggc accccgcggc tgcctgctgc atgcccccga catgtacatg       360
     gagaagatcg ccgtggggcc ggcggccgcg gggaccatcg acatcgagcg gcccattgaa       420
     gagaacctcc aggccgtggc ccgggccctg aacaagcggg tgcaggacgt gacggtcatt       480
     ctgctcgacc ggccgcgcca cgccgacctg gtggcccgca tccgccgggc cggcgcccgc       540
     atccgcatga tctccgacgg cgacgtctcg gctgccatcg ccacggccct ggaggggacc       600
     ggcatcgacc tgatggtggg catcggcggc gccccggaag gggtgctggc ggcggccgcc       660
     ctctactgcc tgggcggcga gctgcagggg cgcctgtggc cggaagacga cgaggaccgc       720
     gagcggatgc gggccatggg gatcgacgag gcccgcgtcc tgcggatcga ggacctggtc       780
     cggggcgagg acgtgatctt cgccgccacc gggatcacca gcggcgagat gctgaagggc       840
     gtgcagttca ccagccgcgg cgccttcacc cactcggtgg ccatgcgcta ccggaccggg       900
     accgtgcgct tcgtcgaagc ctggcaccgg ctggagcgca agcccgtcat cggcccgctg       960
     gtggggggaa ccggcccggg cgcggccggc tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page