(data stored in ACNUC30630 zone)

EMBL: CP002344.PE478

CP002344.PE478       Location/Qualifiers
FT   CDS_pept        568641..569981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0482"
FT                   /product="O-succinylbenzoate synthase"
FT                   /EC_number="4.2.1.-"
FT                   /note="COGs: COG4948 L-alanine-DL-glutamate epimerase;
FT                   InterPro IPR010197: IPR013341: IPR013342; KEGG:
FT                   gtn:GTNG_0815 N-acylamino acid racemase; PFAM: Mandelate
FT                   racemase/muconate lactonizing protein; SPTR: Mandelate
FT                   racemase/muconate lactonizing protein; TIGRFAM:
FT                   o-succinylbenzoic acid (OSB) synthetase; PFAM: Mandelate
FT                   racemase / muconate lactonizing enzyme, C-terminal domain;
FT                   Mandelate racemase / muconate lactonizing enzyme,
FT                   N-terminal domain; TIGRFAM: o-succinylbenzoic acid (OSB)
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50603"
FT                   /db_xref="GOA:E6SGX2"
FT                   /db_xref="InterPro:IPR010197"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX2"
FT                   /protein_id="ADU50603.1"
FT                   /translation="MAAPNESMPPQGPVPPGDRRSPEDPAGSAGPVPPAEPGTVRGAAP
FT                   AGTPTLEPRPIPPMPVEPAAEPVPLTITGVQLFWLRMPLVAPFETSYGRVDRRECLLVR
FT                   LEARHPEAGPVEGWGEVVADADPGYSYETTGTAWHVLSEFVLPALPGRTFETPGQWRAA
FT                   FEWVRGHPMAKAGVEMALLDARSRARGVPLWQEYGGDPGRRRIPVGVSVGIQPTLDDLL
FT                   ATVERWLERGYRRIKIKIKPGYEVEPVRALRERFGDIPLMVDANAAYTLADAERLEALD
FT                   GYGLMMIEQPLHEDDLLDHALLQRRLRTPVCLDESVRHVHAAREALVLGSGRIINIKQG
FT                   RVGGPTDARMIHDLCRRHGIPVWCGGMLETGVGRAHNIALTTLPGFTLPGDTSGSNRYY
FT                   HEDVIDPPVRVGPDGTIEVPQEPGLGFRVVPERVERYTVRHRSWRAS"
     ttggctgcac cgaacgagtc catgccaccg cagggtcccg tgccaccggg cgaccgccgt        60
     tcaccggagg atcccgccgg atcggccggg ccggttcctc cggcggagcc tggcaccgtc       120
     cggggcgcgg cgccggcggg tacccccacc ctggagccgc ggcccatccc gccgatgccc       180
     gtcgagccgg cggcggagcc ggtgcccctg accatcaccg gggtgcagct cttctggctg       240
     cggatgcccc tggtggcccc cttcgagacc agctacggcc gggtggaccg gcgggagtgc       300
     ctgctggtcc ggctggaggc gcgccacccc gaagccggcc ccgtggaggg gtggggcgag       360
     gtggtggccg acgccgaccc cggctacagc tacgagacca cggggaccgc ctggcacgtg       420
     ctgtcggagt tcgtcctgcc cgccctgccc ggccggacct tcgagacgcc gggccagtgg       480
     cgggccgcct tcgagtgggt gcggggccac cccatggcca aggcgggggt ggagatggcg       540
     ctgctcgacg cccgctcccg ggcccgcggc gtgcccctgt ggcaggaata cggaggcgac       600
     cccggccgca ggcggattcc cgtgggcgtc agcgtgggca tccagcccac cctggacgat       660
     ctcctggcca cggtggagcg gtggctcgag cggggctacc ggcggatcaa gatcaagatc       720
     aagccgggtt acgaggtgga accggtccgc gccctgcggg agcgcttcgg cgacatcccc       780
     ctgatggtcg acgccaacgc cgcctacacg ctggcggacg ccgagcggct cgaggccctg       840
     gacggctacg gcctgatgat gatcgaacag cccctgcacg aggacgacct gctggaccac       900
     gccctgctgc agcggcgcct ccggacgccg gtgtgcctgg acgagtcggt caggcacgtc       960
     cacgccgccc gggaggccct ggtcctgggc agtggccgca tcatcaacat caagcagggg      1020
     cgggtgggcg gtcccaccga cgcccgcatg atccacgacc tctgccgccg gcacggcatc      1080
     ccggtgtggt gcggcggcat gctggagacc ggggtggggc gggcccacaa catcgccctg      1140
     accaccctgc cgggcttcac cctgcccggt gacacctcgg gcagcaaccg gtactaccac      1200
     gaagacgtca tcgacccgcc ggtgcgggtc gggcccgacg ggaccatcga ggtgccccag      1260
     gagccgggcc tggggttcag ggtggtgccg gagcgggtcg agcgctacac cgtccggcac      1320
     cggtcctggc gcgcgtcgtg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page