(data stored in ACNUC30630 zone)

EMBL: CP002344.PE480

CP002344.PE480       Location/Qualifiers
FT   CDS_pept        571311..572600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0484"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG0715 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport systems periplasmic components; KEGG: eba:p2A128
FT                   ABC transporter substrate-binding protein; SPTR: NLPA
FT                   lipoprotein; PFAM: NMT1/THI5 like"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50605"
FT                   /db_xref="GOA:E6SGX4"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX4"
FT                   /protein_id="ADU50605.1"
FT                   /translation="MEGTSNLAGGGAAAPAPGRGGPGTAPPVEGGARRAVRGHRRRGRV
FT                   LPGLAAVLAVALLVAACGTAGSSGGGGPAGTPAGAADGGGAGGGSGTGATGDCSQRPGL
FT                   AGVPPLPREVTVKIAEDGAPSGAGFYIATEKGYFRDLCIKPEFVSFESSAYMLPALAAD
FT                   QVQVAGGVLSVGLWNAIESGLELRIIATKGENVPGRSYFNLTVAADQADAIKDYADLKG
FT                   KRIAITAEASLDEQFVDLALQHAGLTRGDVQYVIIRSFGDMNAALANGAVDVAMHIEPL
FT                   ITQAEEQGILKRFGDAGRDYAPGFQIAEVLASPQFVADKELSQRFMLAYVKALRDYNDA
FT                   FIRRDEAKMADIIPIMTKYTALKDPALWKKVYVPGLNPDGRLNVESLKAQLEWYRARGY
FT                   FTGQIDLDQVIDLSLVDYAVQVLGPYDAGR"
     atggaaggaa ccagcaacct ggcgggaggt ggagcggcgg cgccggcccc gggccgcggt        60
     ggcccgggga ccgccccacc ggtggaaggg ggggcccggc gcgccgtccg cggccaccgg       120
     cggcggggcc gcgttcttcc cgggctggcg gccgtcctgg cggtggcgct gctggtggcc       180
     gcgtgcggca cggcgggcag ctccgggggc ggtgggccgg cgggcacgcc ggccggtgcc       240
     gcggacggcg ggggcgcagg cggcggttcg ggcaccggcg ccacgggcga ctgcagccag       300
     cggcccgggc tggccggggt cccgcccctg ccccgggagg tcacggtgaa gatcgcggaa       360
     gacggcgcgc catcgggggc gggcttctac atcgccaccg agaagggcta cttccgcgac       420
     ctgtgcatca agccggaatt cgtcagcttc gagtccagcg cctacatgct gccggccctg       480
     gccgccgacc aggtgcaggt ggcgggcggt gtgctcagcg tcggcctctg gaacgccatc       540
     gagagcgggc tggagctgcg gatcatcgcc accaagggcg agaacgtccc cggccgctcc       600
     tacttcaacc tgacggtggc cgccgaccag gccgacgcga tcaaggacta cgccgacctg       660
     aagggcaagc gcatcgccat caccgccgag gcgtccctgg acgaacagtt cgtggacctg       720
     gccctccagc atgcgggcct gacccgcggc gacgtccagt acgtgatcat ccggtccttc       780
     ggcgacatga acgccgccct ggccaacggg gccgtggacg tggcgatgca catcgagccc       840
     ctgatcaccc aggcggagga acagggcatc ctgaagcgct tcggcgacgc gggtcgggac       900
     tacgcccccg gcttccagat cgccgaggtg ctggccagcc cgcagttcgt cgctgacaag       960
     gagctgtccc aacgcttcat gctggcctac gtcaaggcgt tgcgggacta caacgacgcc      1020
     ttcatccggc gggatgaagc caaaatggcc gacatcattc ccatcatgac gaagtacacc      1080
     gccctcaagg acccggcgct ctggaagaag gtgtacgtcc ccggcctgaa ccctgacggg      1140
     cgcctcaacg tggagagcct gaaggcgcag ctggagtggt accgcgcgcg cgggtacttc      1200
     acgggccaga tcgacctgga tcaggtgatc gacctgtcgc tggtggacta cgcggtgcag      1260
     gtgctcggtc cgtacgacgc gggccggtag                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page