(data stored in ACNUC30630 zone)

EMBL: CP002344.PE481

CP002344.PE481       Location/Qualifiers
FT   CDS_pept        572732..573802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0485"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0600 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system permease component; InterPro IPR000515;
FT                   KEGG: reu:Reut_B5801 binding-protein dependent transport
FT                   system inner membrane protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50606"
FT                   /db_xref="GOA:E6SGX5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX5"
FT                   /protein_id="ADU50606.1"
FT                   /translation="MNRWQHGNGGRGRRRGPGRLAPVLDGQAGGAPDGRAQDGRMPDSR
FT                   RDGRASDGGLRDGRPHDGRPHDGRAHDGRPQADPPVTVLADEPGPRGRGTGAGLTWRRR
FT                   RPVLGRERWLSILSPIAMLLIWEILVRLGWLDARFFPPPSRVAVRFADMVADGTLFHHL
FT                   GISLMRVILGFAAGAVPAVAIGLTMGLFPWVRAVLEPVVAALYPIPKIALLPLLLMIFG
FT                   VGETFKVVTIALGCFTLVLVNTVAGVVNIERIYVDVARNFGASRLDFYRTVAWPGALPM
FT                   IFAGLKLGMGVSLLLIVAAEMIGARSGLGYLIWNSYQVWDMAAMYIGLVLMSFFGYVFT
FT                   MALNELERVVLPWRPR"
     atgaaccgct ggcagcacgg aaacggcggc cgcggccgcc ggcgcggccc aggccggctg        60
     gcgccggtcc ttgacggcca ggccggaggg gcgccggacg gccgagccca ggacggccgg       120
     atgccggaca gccggaggga cggccgcgct tccgacggcg ggctgcggga cggccggccc       180
     cacgacggcc ggccccacga cggccgggcc catgacggcc gcccgcaggc ggatcccccc       240
     gtcacggtgc tggcggacga acccggcccc cgcggccgcg gcaccggagc gggcctgacc       300
     tggcggcgcc gcaggccggt cctcggccgg gagcggtggc tgtccatcct gagccccatc       360
     gccatgctgc tgatctggga gatcctggtc cggctgggct ggctggatgc ccggttcttc       420
     ccgccaccga gccgggtggc cgtgcggttt gcggacatgg tggccgacgg caccttgttc       480
     caccacctgg gcatcagcct gatgcgggtc atcctggggt ttgccgccgg cgccgtcccg       540
     gcggtggcca tcggcctgac catggggctg ttcccctggg tgcgggcggt gctggagccg       600
     gtggtggccg ccctctaccc gatcccgaag atcgcgctgc tgccgctgct gctgatgatc       660
     ttcggcgtcg gcgagacctt caaggtggtc accatcgccc tgggctgctt caccctggtg       720
     ctggtcaaca ccgtggccgg ggtcgtcaac atcgagcgga tctacgtgga cgtggcgcgg       780
     aacttcggcg cctcccgcct cgacttctac cgcaccgtgg cctggccggg cgccctgccc       840
     atgatcttcg ccggcctcaa gctgggcatg ggcgtgtcgc tgctgctcat cgtggcggcg       900
     gagatgatcg gcgcccgcag cggcctgggg tacctgatct ggaactcgta ccaggtctgg       960
     gacatggccg ccatgtacat cggcctggtg ctgatgagct tcttcggcta cgtgttcacc      1020
     atggcgctga acgagctgga gcgggtggtg ctgccctggc ggccgcggta g               1071
//

If you have problems or comments...

PBIL Back to PBIL home page