(data stored in ACNUC30630 zone)

EMBL: CP002344.PE482

CP002344.PE482       Location/Qualifiers
FT   CDS_pept        574043..574855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0486"
FT                   /product="ABC transporter related protein"
FT                   /EC_number="3.6.3.25"
FT                   /note="COGs: COG1116 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system ATPase component; InterPro IPR003439:
FT                   IPR001827: IPR017871: IPR003593; KEGG: eba:p2A125 ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50607"
FT                   /db_xref="GOA:E6SGX6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX6"
FT                   /protein_id="ADU50607.1"
FT                   /translation="MSVPWKIRIRGLRKEFVAGRRVIAALDGIDLEVAEGEFVCLVGPS
FT                   GCGKTTLLRILAGLEKPTAGTIEVAGSDPARPLQAMVFQEQSVFPWMTVRRNIGYGLAL
FT                   RRVPRAERERIVDHYLDLVGLTPFADAYPHQLSGGMKQRVSVARAFAVDPEILLMDEPF
FT                   AALDEQNKLLLAEELLRLWEANRKTVLYVTHSIDEAIHLADRIVVFTASPGRIKAEVPV
FT                   AIPRHRDLDTLRGHPAYAAAYQRVWQALRDEVLAARRHEERERVAGRR"
     atgtccgtgc cgtggaagat ccggattcgc ggcctgcgca aggagttcgt cgccggccgg        60
     cgggtgatcg cggccctgga cgggatcgac ctggaagtgg ccgaggggga gttcgtgtgc       120
     ctggtcgggc cgtcggggtg cggcaagacc acgctgctgc gcatcctggc gggccttgag       180
     aagccgacgg cgggcaccat cgaggtggcc ggcagcgacc ccgcccggcc cttgcaggcc       240
     atggtgttcc aggagcagtc ggtgttcccc tggatgaccg tccggcgcaa catcggctat       300
     ggcctggccc tgcggcgggt cccccgtgcc gagcgggagc gcatcgtcga ccactacctc       360
     gacctggtgg gcctgacgcc ctttgccgac gcctatcccc atcagctctc gggcggcatg       420
     aagcagcggg tcagcgtggc ccgcgccttc gccgtcgacc cggagatcct gttgatggac       480
     gaacccttcg ccgcgctgga cgagcagaac aagctgctgc tggcggagga gctgctgcgc       540
     ctctgggagg cgaaccgcaa gacggtgctc tacgtcaccc actccatcga cgaagcgatc       600
     cacctggccg accgcatcgt ggtcttcacc gcctcgcccg gccgcatcaa ggccgaggtc       660
     ccggtggcca tcccgcggca ccgcgacctg gacaccttgc gcggtcaccc cgcctatgcc       720
     gccgcctacc agcgggtatg gcaggccctg cgggacgaag tgctggccgc ccggcgccac       780
     gaggagcggg agcgggtggc gggccggcgg tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page