(data stored in ACNUC30630 zone)

EMBL: CP002344.PE491

CP002344.PE491       Location/Qualifiers
FT   CDS_pept        585786..586928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0495"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1840 ABC-type Fe3+ transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   rxy:Rxyl_1175 extracellular solute-binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; SPTR:
FT                   Extracellular solute-binding protein, family 1; PFAM:
FT                   Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50616"
FT                   /db_xref="GOA:E6SGY5"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGY5"
FT                   /protein_id="ADU50616.1"
FT                   /translation="MVEPAPRADRSGGPEGSRRPRQRALRPWLRARGGWQRALRRPRGA
FT                   LRLVAVLALAGFVLSGCGVLGRSGRQELVVYSSRTQSLVHPLLEQFARETGIDIKVRYA
FT                   STAELVNTLLEEGERSAADVLYLADAGGWGPLRQAGLLAELPQDVLEKVDPRFRSPDGQ
FT                   WVGVSGRSKVIVYNKNKIDPGRDLPDSVMDLTDPKWKGRIGWAPTHGEWQILVTAIRLT
FT                   KGEDAARQWLEGMKANDPKEYPNLISIVRAVADGEVDIGVVNHYYVPRLMEELGPDFAA
FT                   RNYFLKNGDPGAVIDVTGAAILKSTKNREAAERFVRFLLSEEAQRYFTQETKEYPMIAG
FT                   IPLPAGLPPMEELDPPAIDQSDLGQLQQTVELLRETGVLP"
     gtggtggaac cggccccgcg ggccgacagg tccggcgggc ctgagggttc tcgccgcccg        60
     cggcagcggg cgctgcgccc gtggctgcgg gcccgggggg gatggcagcg ggccttgcgg       120
     cggccccggg gggccctgcg gctggtggcg gtgctggcgc tggccgggtt cgtcctgtcg       180
     gggtgtggcg tgctggggcg cagcggccgg caggagctgg tggtctactc gagccgcacc       240
     cagagcctgg tccacccgct gctggagcag ttcgccaggg agacgggcat cgacatcaag       300
     gtccgctacg ccagcacggc ggagctggtc aacacgctgc tggaggaagg ggagcggagc       360
     gcggccgacg tgctgtacct cgccgacgcc ggcgggtggg ggccgctgcg gcaggcgggc       420
     ctgctggccg aactgcccca ggacgtgctg gagaaggtcg atccccgctt ccgctcgccc       480
     gacggccagt gggtgggggt gtcgggccgt tccaaggtca tcgtctacaa caagaacaag       540
     atcgatcccg ggcgcgacct gcccgattcc gtcatggacc tgaccgaccc caagtggaag       600
     ggtcgcatcg gctgggcgcc cacccacggc gagtggcaga tcctggtcac cgccatccgc       660
     ctcaccaagg gggaggacgc cgcccgccag tggctggagg gcatgaaggc caacgatccc       720
     aaggagtacc ccaacctgat cagcatcgtc cgcgccgtgg ccgacggcga ggtggacatc       780
     ggggtcgtca accactacta cgtcccgcgc ctgatggagg aactcggccc ggacttcgcc       840
     gcccgcaact acttcctgaa gaacggggac cccggcgcgg tgatcgacgt gacgggggcc       900
     gccatcctca agtccaccaa gaaccgggag gcggcggaac ggttcgtccg gttcctgctc       960
     agcgaggagg cccagcggta tttcacccag gagaccaagg agtatcccat gatcgccggc      1020
     atcccgctcc cggcgggcct tccgcccatg gaggagctgg acccgccggc catcgaccag      1080
     agcgacctgg ggcagctgca gcagaccgtc gagctgctgc gggagaccgg ggtgctgccg      1140
     tag                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page