(data stored in ACNUC30630 zone)

EMBL: CP002344.PE503

CP002344.PE503       Location/Qualifiers
FT   CDS_pept        602462..603523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0507"
FT                   /product="ROK family protein"
FT                   /note="COGs: COG1940 Transcriptional regulator/sugar
FT                   kinase; InterPro IPR000600; KEGG: tit:Thit_0081 ROK family
FT                   protein; PFAM: ROK family protein; SPTR: ROK family
FT                   protein; PFAM: ROK family; TIGRFAM: ROK family protein
FT                   (putative glucokinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50628"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGZ7"
FT                   /protein_id="ADU50628.1"
FT                   /translation="MAIHRDRYGTASGDPAPGAAAREAAGAGTAAGTGGGAGDGVVLGI
FT                   DLGGTKIALGLVDRRGKVLADVTLPTEATAGPAAAMDRLAAAARQLAARADRKPLAAGV
FT                   GAPGPLLLPEGRFTGTPNLPGWNGFALRDELARRLGIPVAVNNDANAAALAEARLGAGR
FT                   GAAVMVYVTVGTGIGGGLVVGGKLFSGVNGNGVEIGHTTLDPDGPPCGCGNRGCWEALA
FT                   SGPALARLAGERLGPSPRRPGGQWTAKDLLEAAAAGDPAARAVADEYARRLGVGLANAV
FT                   NAFNPDRLVLGGGVMARYDLLAPAMEAEMRRRALPANAAAVALAPATLGKRAGLVGAAL
FT                   LAWDLLDEPGPGR"
     atggctattc acagggatcg gtatgggacc gcgtccggcg atcccgcgcc aggcgccgcg        60
     gcccgggagg ccgccggggc ggggaccgcc gccggcaccg gcggaggtgc cggggacggg       120
     gtcgtcctgg ggatcgacct cgggggaacc aagatcgctc tgggactggt ggaccgccgg       180
     ggcaaggtgc tggccgacgt caccttgccc accgaggcga cggccggtcc ggcggcggcc       240
     atggaccgcc tcgccgccgc cgcccgccag ctggcggccc gggccgaccg gaagccgctg       300
     gcggccgggg tgggggcgcc gggtccgctg ctgctgcccg agggccggtt caccggcacg       360
     cccaacctgc ccggctggaa cggattcgcc ttgcgggacg agctggcgcg ccggctggga       420
     atccccgtcg ccgtcaacaa cgacgccaac gccgccgccc tggccgaggc gcgcctgggt       480
     gccggccggg gggcggcggt catggtctac gtgaccgtgg gaacgggcat cggcggtggc       540
     ctggtggtcg gcggcaagct gttcagcggg gtcaacggca acggggtgga gatcgggcac       600
     acgaccctgg accccgacgg gccgccctgc ggctgcggca accgcgggtg ctgggaggcc       660
     ctggcctccg gcccggccct ggcccggcta gccggcgagc gtctgggccc ctcgccccgc       720
     cggcccggcg ggcagtggac ggccaaggac ctgctcgagg cggcggccgc cggcgaccct       780
     gccgcgcggg cggtggcgga cgagtacgcc cggcgcctcg gtgtggggct ggccaatgcc       840
     gtcaacgcgt tcaaccccga ccgcctggtg ctggggggcg gggtgatggc ccgttacgac       900
     ctgctggcgc cggcgatgga ggcggagatg cgccgccggg ccctgccggc caacgcggcg       960
     gcggtggccc tggcgccggc caccctgggc aagcgggcgg ggctggtggg ggcggccctg      1020
     ctggcctggg acctgctgga cgaacccggc ccggggcggt ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page