(data stored in ACNUC30630 zone)

EMBL: CP002344.PE54

CP002344.PE54        Location/Qualifiers
FT   CDS_pept        49975..51081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbe:BBR47_06350 hypothetical protein; SPTR:
FT                   Virion structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50179"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKJ2"
FT                   /protein_id="ADU50179.1"
FT                   /translation="MPTIYRTRSGLLFYDDFSAVPLGPSWRVEPESEAARVSLSARPGW
FT                   LQLSHGSVRLFALAPIPDGDLVIEAEVDYDPTDPAEMGGLVLFAAAPDEWAGIVERMDG
FT                   STTVTGWSHLRLVRTGDRWDAYASHDRVTWDWLGAQRFREVTEFGLVLDGAAGDTLDVD
FT                   VVRVYRSTRIRVEAVPAGSTVRLVAEDGTTVLKEAVVPTGATAVELDVGDLRCPIAGSI
FT                   RVYDGAGTMVRDTGLLNDIWGGDVYRAEIMVAVYDDAAKPVPLDREWDFGPVQGTDHAR
FT                   RLELRNDTGLDLADVTVAVIPHPDGTWGDAWVDVAPDAGGVPGTYGDIATIASIPAGTS
FT                   GYVWVRVTRGLDGPPQDRYKFGLRITIP"
     gtgccaacga tctaccgcac tcgatccggc ctgctgttct acgacgactt ttcggccgtt        60
     cccctcggcc cctcctggcg ggtcgagccg gagagcgagg cggcccgggt cagcttgtcg       120
     gcccgccctg ggtggctcca gctctcgcat ggctctgtgc gcctctttgc cctggcgccc       180
     atccccgacg gagacctggt aatcgaagcg gaggtggact acgaccccac cgaccccgcg       240
     gagatgggcg gtctggtgct gttcgcggcc gccccagacg agtgggccgg catcgtggag       300
     cggatggacg gttcgaccac cgtcaccggc tggtcgcacc tgcgccttgt gcggacaggg       360
     gaccgctggg acgcctacgc cagccacgac cgggtgacct gggattggct cggcgcccag       420
     cggttccgcg aggtcacgga gttcggcctg gtcctcgacg gcgccgccgg cgacaccctg       480
     gacgtggacg tggtgcgggt ctaccgctcc acccgcatcc gcgtcgaggc cgtgcctgcg       540
     ggctccacag tgcggctggt ggcagaggac ggcacaacgg ttctcaagga ggctgtggtg       600
     cccaccggcg cgacggcggt ggagctcgac gtgggcgacc tgcgttgtcc catcgccggc       660
     tccatccggg tctacgacgg cgctggcacc atggtccggg acaccggcct gctcaatgac       720
     atctggggcg gcgacgtata ccgcgccgag atcatggtgg cggtctacga cgacgccgcc       780
     aagccggtgc cgttggatcg agagtgggac ttcggcccgg tgcaagggac cgatcacgca       840
     cgccgtctgg agctccgcaa tgacaccggc ctggatctgg ccgatgtgac cgtggcggtg       900
     atcccgcacc cggacggaac ctggggcgat gcctgggtgg acgtggcgcc tgatgccggc       960
     ggcgtgccgg ggacctacgg cgacatcgcc accatcgctt cgatcccggc tggcaccagc      1020
     ggctacgtct gggtccgggt gacgcggggt ctggacggtc cgccgcagga ccgctacaag      1080
     ttcggcttgc gcatcaccat cccgtaa                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page