(data stored in ACNUC30630 zone)

EMBL: CP002344.PE6

CP002344.PE6         Location/Qualifiers
FT   CDS_pept        6838..8745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit; InterPro
FT                   IPR003594: IPR001241: IPR013506: IPR006171: IPR 002288:
FT                   IPR011557: IPR018522: IPR000565; KEGG: tjr:TherJR_0008 DNA
FT                   topoisomerase IV, B subunit; PFAM: DNA topoisomerase type
FT                   IIA subunit B region 2 domain protein; ATP-binding region
FT                   ATPase domain protein; TOPRIM domain-containing protein;
FT                   DNA gyrase subunit B domain protein; PRIAM: DNA
FT                   topoisomerase (ATP-hydrolyzing); SMART: DNA topoisomerase
FT                   II; ATP-binding region ATPase domain protein; SPTR: DNA
FT                   topoisomerase IV, B subunit; TIGRFAM: DNA gyrase, B
FT                   subunit; PFAM: Toprim domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; DNA gyrase B; DNA gyrase B
FT                   subunit, carboxyl terminus; TIGRFAM: DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50131"
FT                   /db_xref="GOA:E6SK07"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6SK07"
FT                   /protein_id="ADU50131.1"
FT                   /translation="MARLGYDESQIQVLEGLEAVRRRPGMYIGSTGPRGLHHLIWEVVD
FT                   NAVDEALAGRCTAITVTLHADGSCSVRDNGGGIPVGIHPKVGKPTVEVVLTMLHAGGKF
FT                   DGQAYKVSGGLHGVGVSVVNALSEWLEVEVRREGRIHRQRYRRGKPDTDLEVVGTTDPA
FT                   DTGTYVRFKPDPEIFEETEFKYDVVVGRLREIALLNSGLYIELKDERTGERNLFQFMGG
FT                   LRSFVALLNRTKEPLHPEPISYKGERDGVEVEMALQWTTSYVETLYSFANTIHTHEGGT
FT                   HEAGFKMALTRVVNDYARKANLIKNGEENLSGDDIREGLTAVLSVKLPEPQFEGQTKTK
FT                   LGNSEVRGVVDSVTGEALATYFEENPQVARRVVEKAITAMRAREAARKARELTRRKSAL
FT                   EVTALPGKLTDCTVRDPAMAELFIVEGDSAGGSAKQGRDRRFQAVLPLRGKILNVEKAR
FT                   LDKILAHDEIRALITAIGTGIGEDFDIQKARYHKIILMTDADVDGAHIRTLLLTFFFRY
FT                   MKPLIEAGYVYIAQPPLYLVRMGKEEHYFYDDDQLEAFFRQIGKRMPAQRFKGLGEMNA
FT                   EQLWETTMNPETRTLLQVTLEDAMAADQIFSILMGSRVEPRREFIEQHARKVRFLDTIG
FT                   "
     gtggcgcgcc tgggatacga cgagagccag attcaggtcc tcgagggcct cgaggccgtc        60
     cggcggcgac cgggcatgta catcggctcc acggggccgc gggggctcca ccacctgatc       120
     tgggaggtgg tggacaacgc cgtcgacgaa gccctggcgg gtcgctgcac ggccatcacc       180
     gtcaccctgc acgccgacgg cagctgcagc gtgcgcgaca acggcggcgg catccccgtg       240
     ggcatccacc ccaaggtggg caagcccacg gtggaggtcg tcctcaccat gctccacgcg       300
     gggggcaagt tcgacgggca ggcgtacaag gtctccggcg gcctgcacgg cgtgggcgtg       360
     tcggtggtca acgccttgtc ggagtggctg gaggtggagg tgcggcgcga gggccggatc       420
     caccgccagc ggtaccgccg cggtaagccc gatacggacc tggaggtcgt ggggaccacc       480
     gatcccgccg acaccggcac ctacgtgcgc ttcaagccgg atcccgagat cttcgaggag       540
     acggagttca agtacgacgt ggtggtgggc cggctgcggg agatcgccct gctcaactcc       600
     ggcctctaca tcgagctgaa ggacgagcgt accggcgagc gcaacctgtt ccagttcatg       660
     ggcggcctgc gctcgttcgt cgcgctgctc aaccgcacca aggaaccgct gcaccccgag       720
     cccatcagct acaagggcga gcgcgacggg gtggaggtgg agatggccct gcagtggacc       780
     acctcctacg tcgagaccct ctactccttt gccaacacga tccacaccca cgaaggcggc       840
     acccacgagg ccggcttcaa gatggccctg acgcgggtgg tcaacgacta cgcccgcaag       900
     gcgaacctga tcaagaacgg tgaggagaac ctgtccggcg acgacatccg cgaggggctg       960
     acggccgtcc tcagcgtcaa gctgcccgag ccccagtttg agggccagac caagaccaag      1020
     ctgggcaact ccgaggtgcg cggggtggtc gactccgtca ccggcgaggc cctggccacc      1080
     tacttcgagg agaatcccca ggtggcccgg cgggtggtgg agaaggccat caccgccatg      1140
     cgggcccggg aggcggcgcg caaggcccgg gagctcaccc ggcgcaagtc ggccctggaa      1200
     gtcaccgccc tgccggggaa gctcaccgac tgcacggtgc gcgacccggc catggccgag      1260
     ttgttcatcg tcgagggcga ctccgccggc ggctccgcca aacagggccg cgaccggagg      1320
     ttccaggccg tgctgcccct gcgcggcaag atcctcaatg tggagaaggc gcggctggac      1380
     aagatcctgg cccacgacga gatccgggcc ctgatcaccg ccatcggcac cggcatcggc      1440
     gaggactttg acatccagaa ggcgcgctac cacaagatca tcctgatgac cgatgccgac      1500
     gtggacggcg cccacatccg gacgctgctg ttgaccttct tcttccgcta catgaagccc      1560
     ctgatcgagg cggggtacgt ctacatcgcc cagccgccgc tgtacctggt gcggatgggg      1620
     aaggaagagc actacttcta cgacgacgac cagctggagg cgttcttccg ccagatcggc      1680
     aagcgcatgc cggcccagcg gttcaagggc ctgggcgaga tgaacgccga gcagctttgg      1740
     gagacgacca tgaacccgga gacccggacg ctgctgcagg tgaccctgga ggacgccatg      1800
     gccgcggacc agatcttctc catcctgatg ggcagccggg tggagccgcg gcgggagttc      1860
     atcgagcagc acgcccgcaa ggtccggttc ctggacacca tcggctga                   1908
//

If you have problems or comments...

PBIL Back to PBIL home page