(data stored in ACNUC30630 zone)

EMBL: CP002344.PE86

CP002344.PE86        Location/Qualifiers
FT   CDS_pept        88866..89342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0086"
FT                   /product="protein of unknown function DUF458"
FT                   /note="COGs: COG1978 conserved hypothetical protein;
FT                   InterPro IPR007405; KEGG: mta:Moth_0053 hypothetical
FT                   protein; PFAM: protein of unknown function DUF458; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF458)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50211"
FT                   /db_xref="InterPro:IPR007405"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL09"
FT                   /protein_id="ADU50211.1"
FT                   /translation="MQTPFISPTRGALSFDAMCAEILDYIRAEPDAQYKLIIGTDSQVR
FT                   QQTQFVTAVVVHRLGKGARYFYQARKQRKITSLRQKIFYEASLSLSLATRLAERLAARG
FT                   GTLPNVEIHLDVGMQGETRDLIREIVGMVVGSGFDAKIKPESYAASSVADRYTK"
     gtgcagacac ccttcatcag cccaacccgc ggtgccctgt cctttgacgc catgtgcgcc        60
     gagatcctgg actacatccg tgccgagccc gacgcccagt acaagctgat catcggcacc       120
     gactcccagg tccggcagca gacccagttc gtgacggcgg tggtggtcca ccgcctcggg       180
     aagggcgcgc ggtacttcta ccaggcgcgc aagcagcgca agatcaccag cctgcggcag       240
     aagatcttct acgaggcgag cctgagcctg tccctggcca cccggctggc ggagcggctg       300
     gcggcccgcg gcggcacgct gcccaacgtg gagatccacc tggacgtggg catgcagggc       360
     gaaacccggg acctgatccg ggagatcgtc ggcatggtgg tgggcagcgg gttcgacgcc       420
     aagatcaagc ccgagtccta cgcggcctcg tcggtggccg accggtacac gaaatga          477
//

If you have problems or comments...

PBIL Back to PBIL home page