(data stored in ACNUC30630 zone)

EMBL: CP002344.PE90

CP002344.PE90        Location/Qualifiers
FT   CDS_pept        91195..92007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: adg:Adeg_2095 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50215"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL13"
FT                   /protein_id="ADU50215.1"
FT                   /translation="MDGVIGAVILAGRRNEGALREIDPAEWEGLVPLAGRPMVAWVASA
FT                   CLEAPSVRQVVLVGPDPAPADAALAQAVEAGRLRVVEPGRDLLGSVRNGLVALQRALPG
FT                   VTGVLLVTGDVPLLTGAMLERFLAAIPAGADVGYPIARRQRMEARFPGAARTYVRLRDG
FT                   EFTGGNALYLRLAAAPRALGWAESLYAARKQPWKLAWMFGPGVLWRVLSRRATVAELER
FT                   RMGGLAGLRAHAVEVADPELAMDVDKVADYRQAEAWLQAAAGGGAARG"
     gtggacggcg tgatcggggc ggtgatcctg gcagggcgcc ggaacgaggg cgccctgcgg        60
     gagatcgacc cggcggaatg ggaggggctc gttcccctgg cggggcggcc catggtggca       120
     tgggtcgcct ccgcatgcct tgaggcgcct tcggtacggc aggtggtgct ggtgggcccg       180
     gacccggcgc cggccgatgc ggccctggcg caggcggtgg aagcgggacg gctccgagtg       240
     gtcgaacccg gccgggacct gctgggcagc gtgcggaacg gcctggtcgc cttgcagcgg       300
     gccttgcccg gggtgaccgg cgtcttgctg gtgacgggcg acgtgccgct gctgacgggg       360
     gccatgctgg agcggttctt ggccgccatc cccgccgggg ccgacgtagg ctatcccatc       420
     gcccggcggc agcggatgga agcccgcttc cccggtgccg cccgcaccta cgtgcgcctg       480
     cgggacggcg agttcaccgg gggcaacgcg ctctacctgc ggctggcagc ggcgccgcgg       540
     gccctggggt gggccgaatc cctctacgcc gcccgcaagc agccgtggaa gctggcctgg       600
     atgttcggtc ccggggtgct ctggcgcgtg ctgtcccgcc gggccacggt ggcggagctg       660
     gagcggcgga tgggcggcct ggccggcctg cgggcccacg ccgtcgaggt cgccgacccg       720
     gagctggcca tggacgtgga caaggtcgcc gactaccgcc aggccgaggc gtggctgcag       780
     gcagcggccg gaggaggggc cgcccgtggc taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page