(data stored in ACNUC30630 zone)

EMBL: CP002344.PE98

CP002344.PE98        Location/Qualifiers
FT   CDS_pept        98881..99504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0098"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="COGs: COG1825 Ribosomal protein L25 (general stress
FT                   protein Ctc); InterPro IPR020055: IPR001021; KEGG:
FT                   adg:Adeg_1818 50S ribosomal protein L25/general stress
FT                   protein Ctc; PFAM: Ribosomal protein L25-like; SPTR: 50S
FT                   ribosomal protein L25; TIGRFAM: ribosomal 5S rRNA E-loop
FT                   binding protein Ctc/L25/TL5; PFAM: Ribosomal L25p family;
FT                   TIGRFAM: ribosomal protein L25, Ctc-form"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50223"
FT                   /db_xref="GOA:E6SL21"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL21"
FT                   /protein_id="ADU50223.1"
FT                   /translation="MQAVLRAVPREPGHARRVRREGGIPAVLYGPSGNFPVRLDAREFH
FT                   RLLASGRARGVLTVELVRDGQTRQLSAMVKELQWHPARGDLLHVDLFEVREDEPVRAVV
FT                   PIALTGTEEAEKRGIVQHQLAELEIECLPRYIPPVVEADVANLPVGEEVRVKDLVVPPQ
FT                   VRVLNDPDEIVAVLLPPKELVDEEAQPEEAGEAAAAAPKTEGES"
     gtgcaggccg ttctgcgcgc ggtaccccgg gaacccggcc acgcccggcg ggtgcgccgc        60
     gagggcggga tcccggcggt actctacgga cccagcggga acttccccgt ccggctcgac       120
     gcccgggaat tccaccggct gctggcgtca gggcgggcgc ggggcgtgct gacggtggag       180
     ctggtccgcg acgggcagac ccgccagctc agcgccatgg tcaaggagct gcagtggcac       240
     cctgcgcggg gcgatctgct ccacgtggac ctcttcgagg tgcgggagga cgagcccgtc       300
     cgcgcggtgg tccccatcgc cctgacgggg acggaggaag cggagaagcg gggcatcgtc       360
     cagcaccagc tggcggagct ggagatcgag tgcctgccgc ggtacatccc gccggtggtg       420
     gaggcggacg tcgcgaacct gcccgttggc gaagaggtgc gggtgaagga tctcgtggtg       480
     ccgccccagg tacgggtgct caacgacccg gacgagatcg tggcggtgct gctgccgccg       540
     aaggagctgg ttgacgagga ggcccagccc gaagaggccg gtgaggctgc cgcggcggcg       600
     ccgaagaccg aaggcgagag ttga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page