(data stored in ACNUC7421 zone)

EMBL: CP002355.PE1

CP002355.PE1         Location/Qualifiers
FT   CDS_pept        70..1398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation; InterProIPR001957: IPR020591: IPR013317:
FT                   IPR013159: IPR 003593; KEGG: tdn:Suden_0001 chromosomal
FT                   replication initiation protein; PFAM: Chromosomal
FT                   replication initiator DnaA; Chromosomal replication
FT                   initiator DnaA domain; SMART: Chromosomal replication
FT                   initiator DnaA domain; AAA ATPase; SPTR: Chromosomal
FT                   replication initiator protein dnaA; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA; PFAM: domain; Bacterial
FT                   dnaA protein; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32669"
FT                   /db_xref="GOA:E4TW53"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW53"
FT                   /protein_id="ADR32669.1"
FT                   /translation="MNSIGKQVLNALKGEINEIDYQRYIKQLTYDEAESKSNIAVFRAP
FT                   NTLIANWVRTKFADKIAHLFEIKTNVKPTVSILIQSTSVQSSVQNTVAVPNIERPGGSL
FT                   LNPSFTFQNFVVGDSNNFAFIAAKNVSEKPGVVYNPLFIYGGVGLGKTHLMQSVGNVML
FT                   SQGKTVIYTSVEQFLNDFTRHLSNRTMDRFKDKYRKCDLLLIDDIQFLSNKNQIQEEFF
FT                   HTFDALRNENKQIIITSDKPPKKIGGLEERLKSRFESGLVADIQPPELETKIEIIKKKC
FT                   EINRVKLDREVINYVATIIENNTREIEGILSKLNAYSQLMGVDITIEFARNVLKEQMAE
FT                   KRSNITTDLIMDTVAKELNIKPSEIRSKSRNSNIVYARRIAIYLSRTLTPNSMPQLAQY
FT                   FGMKDHTAVSHTMKKIQELMKNDEDFRVKIEELSNKVSVATPE"
     atgaattcaa tcggtaaaca ggttttaaat gctctcaaag gggagatcaa tgagatcgat        60
     taccaacgct atattaaaca gctaacgtat gacgaagccg aatccaaaag caatatagcg       120
     gtttttcgtg ctcctaatac ccttatagcc aactgggtac ggacaaaatt tgccgataaa       180
     atcgctcatc tttttgaaat taaaaccaat gtaaaaccta ctgtatcgat tttaatacaa       240
     tctacttccg ttcaatcttc ggtacaaaat accgtagccg tacctaatat cgaacgcccg       300
     ggcggatcac tgcttaaccc ctcgtttact tttcaaaact ttgttgtggg cgattccaat       360
     aattttgcct ttatcgcagc caaaaacgtg agtgaaaaac cgggggtcgt ttacaatccc       420
     ctctttatct acggcggtgt aggactggga aaaacccatt tgatgcaatc ggtcggaaat       480
     gtaatgctat cccaaggaaa aacggttatt tatacttccg tagagcagtt tctaaacgat       540
     tttacccgcc atctcagcaa ccggaccatg gatcgtttta aagataaata ccgcaaatgt       600
     gatttactcc ttatcgacga tatccagttt ttaagtaata aaaaccaaat acaggaagag       660
     tttttccata cgtttgatgc ccttcgaaac gaaaacaagc agatcattat tacttccgat       720
     aaacctccta aaaaaatcgg aggtctagaa gagcgcttga aaagccgttt tgaatcgggt       780
     ctcgtagccg atatccagcc tcctgaactc gaaaccaaaa tcgagatcat caagaaaaaa       840
     tgtgaaatca accgtgttaa actcgatcgc gaagttatta attatgttgc aaccattatt       900
     gaaaacaata cccgcgaaat cgaaggaatc ctctcaaaac tcaatgccta ttcacaattg       960
     atgggtgtcg atatcacgat cgaatttgcg cgtaatgtcc ttaaagagca gatggctgaa      1020
     aaacggagca atatcaccac cgatctcatt atggataccg ttgccaaaga gcttaatatc      1080
     aaaccgagtg aaatacgctc caaaagccgt aatagcaata tcgtatatgc acgccgaatc      1140
     gctatttatc tctcccgtac ccttactccg aattctatgc ctcaattggc tcagtatttc      1200
     ggaatgaaag atcatacggc cgtcagccat accatgaaaa aaattcagga actgatgaaa      1260
     aacgacgaag atttccgcgt taaaatagaa gaactttcca ataaagtttc tgttgccact      1320
     ccggaataa                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page