(data stored in ACNUC7421 zone)

EMBL: CP002355.PE10

CP002355.PE10        Location/Qualifiers
FT   CDS_pept        complement(11037..12449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0010"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR004358: IPR005467: IPR003661: IPR003594; KEGG:
FT                   tdn:Suden_1558 histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; SPTR: Histidine kinase; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32678"
FT                   /db_xref="GOA:E4TW62"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW62"
FT                   /protein_id="ADR32678.1"
FT                   /translation="MLRIHQLFFLNVLGLFVAALFVASLISYFTLKSMIINDSEERLIE
FT                   NINLLEPLLTSTNDFDRFVAQAAGKTFLRVTVIDENGNVMAESDADKTTMENHIGRVEV
FT                   MHAMTEPYGTAIRYSKTVKTDFIYVAHKIVTPERTFYIRLAMSLEGVMKHFYVLWIQLV
FT                   GGFGILVVIALLIAYNISKKARYDILQITRYLDEVSAKNYRAVLKPEYFREFLQISILL
FT                   KNLVKKLHNRDKQKRKHTAKLRLINKQQNDILSAISHEFKNPIAAIMGYAETLHDDLNI
FT                   DPKIREKFLDKILSNTQRVTLMLDRLALSVKLENNDLSIKPSSFNISDICHDSISILQA
FT                   KYPARSITYHGTAKTVFADKTMIELIITNLIDNALKYSDEEVTVTLTDNTLSVSDKGIG
FT                   IAQSELDKITSKFYRVQKNRWDNSMGLGLSIVSYILKLHDSELRIESILGIGSTFSFSL
FT                   ANLVEKKGPSKK"
     gtgctaagga tccatcagct tttctttctt aatgttttag gcctttttgt cgccgcattg        60
     ttcgttgctt cgctaatcag ctattttacc cttaaatcca tgatcataaa tgacagtgaa       120
     gagcggctga ttgaaaatat caatctttta gagcctctgc tgacttcaac caacgatttt       180
     gaccgttttg ttgcccaagc cgccggaaaa acctttctac gggttaccgt tatcgacgaa       240
     aacggaaatg tcatggctga aagcgatgcc gataaaacga cgatggaaaa ccatatcgga       300
     cgggtagaag taatgcatgc catgacggag ccttacggaa cggctatccg atattcaaaa       360
     acagttaaaa ccgatttcat ctatgtcgcc cataaaattg ttacacccga acggacattt       420
     tacatccgcc ttgctatgag tctcgaaggg gtaatgaaac acttttacgt cttatggatt       480
     cagcttgtcg gaggtttcgg catactggtc gttatcgccc tgctaatcgc ttacaacatc       540
     tccaaaaaag cacgttacga tatcctccaa attacccgtt atttggatga agtttctgcc       600
     aaaaactacc gggcggttct caaaccggaa tactttcgcg agtttttgca aatttcgatt       660
     cttctcaaaa atctggttaa aaaacttcat aaccgtgaca aacaaaagcg taagcacacc       720
     gccaaactgc gcctcatcaa caaacagcaa aacgatatcc tctccgcaat cagccatgaa       780
     ttcaaaaacc ccatcgccgc cattatggga tatgccgaaa cactccatga tgatttgaat       840
     atcgatccca aaattcgtga aaagtttttg gataaaatcc tctccaatac ccaacgcgtt       900
     actttgatgc tggaccgtct ggcactttcc gtaaaactag aaaacaacga cctctccatt       960
     aaaccttcgt cattcaatat ttccgacata tgtcatgatt cgatctctat tctgcaagcc      1020
     aaatatccgg cacgctccat tacttaccac ggtacggcaa aaaccgtttt tgccgataaa      1080
     acgatgattg aactaatcat taccaatctc atcgacaatg cactcaaata ttcggatgaa      1140
     gaggtaacgg tgacactaac ggataatacc ctgagcgtta gcgacaaagg gatcggaatc      1200
     gctcaatcag aacttgataa aattacttca aaattttacc gcgtccaaaa aaaccgctgg      1260
     gacaactcca tggggcttgg actctccatc gtcagctata ttttaaaact gcatgattcc      1320
     gaacttcgga tagagagtat actcggaatc ggatctacct ttagcttttc cctcgcaaat      1380
     ctcgtcgaaa aaaagggccc ttccaaaaaa tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page