(data stored in ACNUC7421 zone)

EMBL: CP002355.PE100

CP002355.PE100       Location/Qualifiers
FT   CDS_pept        98312..98866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0100"
FT                   /product="Spermine synthase"
FT                   /note="COGs: COG0421 Spermidine synthase; InterPro
FT                   IPR001045; KEGG: tdn:Suden_2048 spermidine synthase-like;
FT                   PFAM: Spermine synthase; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32768"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT7"
FT                   /protein_id="ADR32768.1"
FT                   /translation="MKTFIYPEMMTHVAMCTHKNPRSVMIISNQSDLIKVEMGRYREVD
FT                   TEYLDANNLLTALRDRADKESDVLLLDTLSDDSAVFAHVNRILKDDALMVLKHPDLDDV
FT                   SANTKLMQILGNYFKIIMPYHLEDGSTLLLCSKEYHPTADLILQRSDLLEGHHYYNCDI
FT                   HIAAFAMPQYIRKNYLGIIRN"
     atgaaaacat ttatttatcc agaaatgatg acccatgttg ccatgtgtac ccataaaaat        60
     ccccgttctg taatgattat cagcaatcaa agcgatttga ttaaagtaga aatggggcgt       120
     taccgcgagg tagacaccga gtatttggac gcaaacaatc ttctcaccgc attacgtgac       180
     cgagccgaca aagagagcga tgtgttactt ttggatacgc tgagcgatga tagcgccgta       240
     ttcgcccatg taaaccgtat tttaaaagat gacgctctga tggtattaaa acaccctgat       300
     ttggacgatg tgagtgctaa taccaagttg atgcaaattt tggggaacta tttcaaaatt       360
     ataatgcctt atcatttgga agacggctca acgcttttac tctgctccaa agagtaccat       420
     ccgacagctg acctgatttt gcagcgaagc gacttgctgg aagggcacca ctactataac       480
     tgcgatattc acattgccgc attcgcgatg ccgcaataca tccgtaaaaa ttacctcggg       540
     attattcgta attaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page