(data stored in ACNUC7421 zone)

EMBL: CP002355.PE101

CP002355.PE101       Location/Qualifiers
FT   CDS_pept        98866..99471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0101"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COGs: COG0237 Dephospho-CoA kinase; InterPro
FT                   IPR001977; KEGG: tdn:Suden_2047 dephospho-CoA kinase; PFAM:
FT                   Dephospho-CoA kinase; PRIAM: Dephospho-CoA kinase; SPTR:
FT                   Dephospho-CoA kinase; TIGRFAM: dephospho-CoA kinase; PFAM:
FT                   Dephospho-CoA kinase; TIGRFAM: dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32769"
FT                   /db_xref="GOA:E4TWT8"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT8"
FT                   /protein_id="ADR32769.1"
FT                   /translation="MAFEYAIALTGGIATGKSTVASLLGLNGLRIIDADTIAHRILDEN
FT                   SAWVSERFGSEFVKNGKVDRPSLGKIVFADAQAKKELENFLHPKIRAAIEEESEKQDRL
FT                   KYPYLIDIPLFFETASYPIKNSVVVYTPKALQLERFMKRNGFSEEESLRRIESQMDIEE
FT                   KKKRATWVIDNSSNLKHLQCECEQFVESIKALYPAPKV"
     atggcgtttg aatatgctat tgcattgacg ggagggatag cgacggggaa aagtaccgtt        60
     gcctcgttat tagggctaaa cggtcttcgt attatcgatg ccgatacgat tgcccatcgg       120
     atattggatg aaaacagcgc atgggtcagt gagcggttcg ggagcgaatt tgtcaaaaac       180
     ggcaaagtgg accgtccctc tctcggtaaa atagtttttg ccgacgcgca agcgaaaaaa       240
     gagctggaaa attttcttca tccgaaaatc cgcgccgcca tcgaagagga gagcgaaaaa       300
     caagatcgcc tcaaataccc ttacctgatc gatattcccc ttttctttga gacggcatcg       360
     tatccgatca aaaattctgt ggtcgtttat acccccaaag ctttgcagct ggagcgtttt       420
     atgaagcgca acggtttttc cgaggaagag tcgcttcgcc gaatcgagag tcagatggat       480
     atcgaggaga agaaaaagcg cgcaacgtgg gtgattgaca actcctccaa tctcaaacat       540
     ttacagtgtg agtgtgaaca gtttgtggag tcgattaaag cactctaccc cgctcctaag       600
     gtataa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page