(data stored in ACNUC7421 zone)

EMBL: CP002355.PE103

CP002355.PE103       Location/Qualifiers
FT   CDS_pept        complement(100517..101584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0103"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /note="COGs: COG0216 Protein chain release factor A;
FT                   InterPro IPR000352: IPR004373: IPR005139; KEGG:
FT                   tdn:Suden_2045 peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; SPTR:
FT                   Peptide chain release factor 1; TIGRFAM: peptide chain
FT                   release factor 1; PFAM: PCRF domain; RF-1 domain; TIGRFAM:
FT                   peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32771"
FT                   /db_xref="GOA:E4TWU0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU0"
FT                   /protein_id="ADR32771.1"
FT                   /translation="MLSDKLTPFINRYNELTELLSSPDIGNDIKRMTELSKEQSSIQAI
FT                   VNKATEYKKLLEDIEENKSLAFDAELGELAKEELRTLEPMVEPLEEEIKKLLIPADPND
FT                   KRNIYIELRAGTGGDEAAIFVGDLFNAYVRYADVKGWKIELMSSSPSDAGGYKEIIALI
FT                   KGEQVYSRLKYEAGTHRVQRVPATESQGRVHTSAITVAVMPEVDDVEVTINENDLKIDV
FT                   MRSSGSGGQSVNTTDSAVRITHLPTGIVVTNQDEKSQHKNKDKAMKILKARIYEMQMEE
FT                   AKVKEMSERKEQVGTGDRSGRIRTYNYPQNRISDHRINLTLYRLDEIMQGGLMDDIIEP
FT                   LIADAQAQIMERAGL"
     atgttatccg acaaactcac cccgtttatc aaccgttaca acgaactaac cgaacttctc        60
     agttctcccg atatcggcaa tgacatcaaa agaatgaccg aactctcaaa agagcaatct       120
     tccatccaag ccattgtaaa taaagcgact gagtacaaaa aactcctcga agatatcgaa       180
     gagaacaaat cacttgcttt tgatgcggaa ctcggcgaac tggccaaaga ggaacttaga       240
     acactagaac cgatggtaga acctctggaa gaggagatta aaaaactcct cattccggcc       300
     gatccgaatg ataaacgaaa catttatatc gagcttagag ccggtacggg cggagacgaa       360
     gcggccattt ttgtcggtga tttgttcaat gcctatgtcc gttatgccga tgtcaaggga       420
     tggaaaatcg aactgatgag ttccagccca tccgatgcgg gaggatacaa agagatcatt       480
     gccctcatca aaggggagca ggtttactca cggctcaagt acgaggcggg aacgcaccgc       540
     gtacagcgtg tccctgcaac cgagtctcag ggacgtgttc atacttccgc gatcaccgtt       600
     gccgtcatgc ctgaagtcga tgacgtcgag gtgactatca atgaaaatga tcttaaaatc       660
     gatgttatgc gttcctccgg atcgggagga caaagcgtca atacgaccga ttcggcggta       720
     cgaatcaccc accttcctac cggcatcgtc gtcaccaatc aggacgaaaa atcgcagcat       780
     aaaaacaaag acaaagcgat gaaaatcctc aaagcccgta tctacgagat gcagatggaa       840
     gaggcaaaag tcaaagagat gagtgaacgt aaagagcagg taggaaccgg ggatcgatca       900
     gggcgtatcc gtacctacaa ctatccgcaa aaccgtatct ccgaccaccg tatcaacctc       960
     accctttacc gtctcgatga gattatgcag gggggattga tggatgatat tatcgagccg      1020
     ttgattgctg atgcgcaggc gcagataatg gagagagcgg gcttataa                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page