(data stored in ACNUC7421 zone)

EMBL: CP002355.PE104

CP002355.PE104       Location/Qualifiers
FT   CDS_pept        complement(101652..101918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0104"
FT                   /product="SSU ribosomal protein S20P"
FT                   /note="COGs: COG0268 Ribosomal protein S20; InterPro
FT                   IPR002583; KEGG: tdn:Suden_2044 30S ribosomal protein S20;
FT                   PFAM: ribosomal protein S20; SPTR: 30S ribosomal protein
FT                   S20; TIGRFAM: ribosomal protein S20; PFAM: Ribosomal
FT                   protein S20; TIGRFAM: ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32772"
FT                   /db_xref="GOA:E4TWU1"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU1"
FT                   /protein_id="ADR32772.1"
FT                   /translation="MANHKSALKRIRQTEKRTERNRFYRTRIKNIVKAVRAAVDAGNKE
FT                   EAQAALVIANANLHKYVSKGILKKETAARKVSRLHLAVNAIAA"
     atggcaaacc ataagtcagc attgaaacgt atccgtcaga cggaaaagcg tacagaacgc        60
     aaccgattct atcgcacacg tattaaaaac attgttaaag cagtccgcgc tgcagtagat       120
     gcaggaaata aagaagaagc acaagctgct cttgttattg ccaacgctaa ccttcacaaa       180
     tatgtcagca aaggcatttt gaaaaaagag actgctgctc gtaaagttag ccgtcttcac       240
     ctcgctgtta acgcaatcgc agcataa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page