(data stored in ACNUC7421 zone)

EMBL: CP002355.PE105

CP002355.PE105       Location/Qualifiers
FT   CDS_pept        102045..103385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0105"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="COGs: COG1109 Phosphomannomutase; InterProIPR016066:
FT                   IPR006352: IPR005841: IPR005844: IPR 005845: IPR005846:
FT                   IPR005843; KEGG: tdn:Suden_2039 phosphoglucosamine mutase;
FT                   PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase; SPTR:
FT                   Phosphoglucosamine mutase; TIGRFAM: phosphoglucosamine
FT                   mutase; PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   C-terminal domain; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I; TIGRFAM: phosphoglucosamine
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32773"
FT                   /db_xref="GOA:E4TWU2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU2"
FT                   /protein_id="ADR32773.1"
FT                   /translation="MKLFGTDGVRGEAGSFLTAELAMRVAMAAGIYFSEHARTKKILLG
FT                   KDTRKSGYMIENAIVSGLTAVGYDVVQIGPMPTPAIAFLTLNMRCDAGIMISASHNPFE
FT                   DNGIKFFDAHGNKLSEEIEAQIEAIAHDKARLEEGQVTGKNIGSAKRIDDVIGRYIVQL
FT                   KNSFSRELTLQGLRIVLDTANGAGYKVGPTVLEELGAEVIVLHDKPNGFNINEGCGAMH
FT                   TKDLREAVKQYRADIGLALDGDADRLIVVDENGDEVDGDQILGSLGLFLNKNGQLKGGG
FT                   IVATVMSNQALEDTMNENGLKLFRSNVGDKYVLEVMRENGINFGGEQSGHIILHDYAKT
FT                   GDGLVSALQILALLLTSGQKASKVLRPFKLYPQKLVNIKVKTKKPLDQIEGLSEELAKI
FT                   ESAHMRHLIRYSGTENKLRILLEGKDAKVMEKSMEHLVSFFEKALNG"
     atgaaactct ttggaacgga tggggttcgc ggtgaagcgg gctcattttt aacggcagaa        60
     ttggcgatgc gtgtcgcgat ggcggcagga atttacttta gcgagcatgc acgaaccaaa       120
     aagattttgc tgggcaaaga tacccgtaaa agcggctata tgatcgaaaa tgcgattgta       180
     agcggtctga cggctgtggg gtatgatgtc gtacagatcg gtccgatgcc gactccggca       240
     atcgcatttt tgacgttgaa tatgcgctgt gatgcgggga ttatgatttc agcgagccat       300
     aacccttttg aagacaacgg aatcaaattt ttcgatgcac acgggaacaa gctttccgaa       360
     gagattgaag cgcagattga agcgattgcc cacgataaag ctcgtcttga agagggacag       420
     gtgacgggaa aaaacatcgg ttcggctaaa cggatcgatg acgttatcgg ccgatacatt       480
     gttcaactga aaaattcatt cagccgtgaa ttgacgcttc aggggctccg tattgttttg       540
     gatacagcca acggggcagg gtacaaagtg gggccgacgg tgctcgaaga gttaggtgcc       600
     gaagtgatcg tgctgcatga caaacccaac gggtttaata ttaatgaggg gtgtggagca       660
     atgcacacca aagatttgcg tgaagcggtg aaacagtacc gcgcggatat cggtttggca       720
     ctcgatgggg atgcagatcg tcttattgtt gtggatgaaa atggtgacga ggttgacggc       780
     gatcagatat taggctcatt ggggctcttt ttaaacaaaa acgggcagct taaagggggc       840
     ggaatcgtag caaccgtcat gagtaatcag gcgttggaag atacgatgaa tgagaacggc       900
     ttgaaacttt tccgctcaaa cgtaggggat aaatacgtgt tggaagtgat gcgtgagaac       960
     gggattaact tcggcgggga gcaaagcggt cacattattt tacatgatta cgccaaaacg      1020
     ggagacggtt tggtaagcgc acttcaaatt ttggcattgc ttctcacatc ggggcaaaaa      1080
     gcaagtaaag tgctccgtcc gtttaaactt tatccgcaaa aattggtcaa tatcaaagtc      1140
     aaaacgaaaa agccgctcga tcagattgag gggctcagtg aagagcttgc taaaatagag      1200
     agtgcacata tgcgtcattt gattcgctat tcgggtacgg agaataaact ccgtattttg      1260
     ttagagggta aagatgctaa ggtaatggaa aaatcgatgg aacatcttgt gagctttttt      1320
     gagaaggcct tgaatggtta g                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page