(data stored in ACNUC7421 zone)

EMBL: CP002355.PE107

CP002355.PE107       Location/Qualifiers
FT   CDS_pept        104046..105854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0107"
FT                   /product="Ser-tRNA(Thr) hydrolase; threonyl-tRNA
FT                   synthetase"
FT                   /EC_number="3.1.1.-"
FT                   /EC_number="6.1.1.3"
FT                   /note="COGs: COG0441 Threonyl-tRNA synthetase;
FT                   InterProIPR002320: IPR018158: IPR006195: IPR012947: IPR
FT                   002314: IPR004154; KEGG: tdn:Suden_0066 threonyl-tRNA
FT                   synthetase; PFAM: tRNA synthetase class II (G H P and S);
FT                   Threonyl/alanyl tRNA synthetase SAD; Anticodon-binding
FT                   domain protein; SPTR: Ser-tRNA(Thr) hydrolase /
FT                   threonyl-tRNA synthetase; TIGRFAM: threonyl-tRNA
FT                   synthetase; PFAM: Anticodon binding domain; Threonyl and
FT                   Alanyl tRNA synthetase second additional domain; tRNA
FT                   synthetase class II core domain (G, H, P, S and T);
FT                   TIGRFAM: threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32775"
FT                   /db_xref="GOA:E4TWU4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU4"
FT                   /protein_id="ADR32775.1"
FT                   /translation="MDIIAIKHNDQIVDLQTAGALGITGEEIAYDNSPDALEVIRHSCA
FT                   HLMAEAIKALYTDAKFFVGPTVKEGFYYDFKVNETIGEDDLKTIEKKMLDIAKGKEKIE
FT                   RYEITKNEARAKFANDHLKQAVMDRIPSDTVTIYKQGEFEDLCRGPHLPSVGLLRYFKL
FT                   TKISGAYLGGDSKNEMLTRIYGIAFADKESLKAYLDQMAEAEKRDHRKIGAEMKLFTFR
FT                   EEVGAGFPIWLPAGARMRSRLEQLLFKAHRKRGYEPVRGPEMLRSDLWKVSGHYQNYGE
FT                   NMYFTHIDELEFGVKPMNCVGHIKVYEHDLHSYRDLPLKYFEYGVVHRHEMTGALHGLF
FT                   RVREFTQDDAHIFCTADQIEQQIIEVVDFVDKIMKTFEFNYKMMISTKPEKAVGDDAVW
FT                   EISTNALKTAMDKNNLSYEIDEGGGAFYGPKIDIKITDAIGREWQCGTIQLDFNLPARF
FT                   ELEYNGEENAKIQPVMIHRAILGSFERFVGILTEHYAGEFPMFIAPTQVAIVPIAPTHE
FT                   AYARELADKLIDMGADFEIFDKNESLNKRIRTAEKGRVPMIIVLGDEEVANKSIAVRDR
FT                   RSREQYNLSEEDFISLVKQKINEVHF"
     atggatatta ttgcgatcaa gcacaacgat caaatagttg atttacaaac cgccggggca        60
     cttggaatta cgggtgaaga gatcgcttat gataactctc ccgatgcact ggaagtgatt       120
     cgccactcct gtgcccactt aatggccgag gcgatcaaag ctctttatac tgatgctaaa       180
     ttttttgtcg gaccgactgt taaagagggt ttctattatg attttaaagt caatgaaacg       240
     atcggtgaag atgatctaaa aaccattgaa aaaaagatgc tcgatattgc caaaggtaaa       300
     gagaaaatcg agcgttacga aattaccaaa aatgaagcgc gtgcaaaatt tgccaacgat       360
     cacctcaagc aggcggttat ggatcgcatt ccaagcgata cggtaaccat atacaagcag       420
     ggtgaatttg aagacctttg ccgcggtccg catttgccga gtgtcggatt gctgcgttac       480
     tttaaactga cgaagatttc cggggcctat ctcggcggtg acagcaaaaa cgaaatgttg       540
     acccgtatct acggtatcgc gtttgccgat aaagagtcac tcaaagcata ccttgatcaa       600
     atggcggaag cggaaaaacg cgatcaccgc aaaatcggtg ccgagatgaa gctgttcact       660
     ttccgcgaag aggtcggtgc gggattcccg atctggcttc ctgcgggtgc gcgcatgcgt       720
     tcacgcctcg aacagctcct tttcaaagcg caccgcaaac ggggttatga gccggttcgc       780
     ggtcctgaga tgcttcgctc agacttatgg aaagtatcgg gtcactatca aaactacggc       840
     gaaaacatgt atttcaccca tatcgatgag ctggagttcg gggttaaacc gatgaactgt       900
     gtcggccata ttaaagtata cgagcatgat ctgcattcgt atcgcgatct tcctctcaaa       960
     tatttcgaat acggggtcgt tcaccgtcat gagatgacag gagcacttca cgggttgttc      1020
     cgtgtccgtg aatttaccca agacgatgcg cacatcttct gtaccgccga tcaaatcgag      1080
     cagcagatca tcgaagtcgt cgatttcgtt gataaaatta tgaaaacatt tgagtttaac      1140
     tataaaatga tgatttcgac gaaacctgaa aaagcagttg gagatgacgc ggtttgggag      1200
     atttctacta acgcattgaa aacggcgatg gataaaaaca acctctctta tgaaatagat      1260
     gaggggggcg gagcgttcta cggccctaaa atcgatatca aaattaccga tgctatcggg      1320
     cgcgaatggc agtgcgggac gatccagctg gatttcaatc tcccggcacg tttcgagctt      1380
     gaatacaacg gcgaagagaa tgctaaaata caaccggtta tgattcatag agcgatttta      1440
     ggttcgtttg agcgatttgt tggtatattg acggagcatt acgctgggga attcccgatg      1500
     ttcatcgctc cgacgcaggt tgcaatcgtt ccgattgccc ctacgcacga agcatatgca      1560
     cgtgaattag ccgataaatt gatcgatatg ggtgccgatt ttgagatttt cgataaaaat      1620
     gagagtctta acaaacggat ccgtacagcg gaaaaagggc gcgttcctat gatcatcgtt      1680
     ctcggtgatg aagaggtcgc taataaaagc attgcggtgc gtgatcgacg atcgcgcgag      1740
     caatacaacc tgagcgaaga ggatttcatc tctctggtta aacaaaaaat taatgaggta      1800
     catttttga                                                              1809
//

If you have problems or comments...

PBIL Back to PBIL home page