(data stored in ACNUC7421 zone)

EMBL: CP002355.PE108

CP002355.PE108       Location/Qualifiers
FT   CDS_pept        105851..106381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0108"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /note="COGs: COG0290 Translation initiation factor 3
FT                   (IF-3); InterPro IPR019813: IPR001288: IPR019814:
FT                   IPR019815; KEGG: tdn:Suden_0067 translation initiation
FT                   factor IF-3; PFAM: Translation initiation factor 3-like;
FT                   SPTR: Translation initiation factor IF-3; TIGRFAM:
FT                   translation initiation factor IF-3; PFAM: Translation
FT                   initiation factor IF-3, C-terminal domain; Translation
FT                   initiation factor IF-3, N-terminal domain; TIGRFAM:
FT                   translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32776"
FT                   /db_xref="GOA:E4TWU5"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU5"
FT                   /protein_id="ADR32776.1"
FT                   /translation="MIKKQDRVLMNEDIRVPEVRCVVDGGEALGIISINEAMNKANEMG
FT                   LDLVLISPDAKPPVAKIMDYGKFHYQEEKKKKEARKKQTKVEVKEIKLSVKIADNDVGY
FT                   KVKHAREFLEEGKHVHFRVFLRGREMAHPESAVAVLQRVWPMVEDIGTMYKAPQMEGRY
FT                   CNMMIHPKKDDKK"
     ttgattaaga aacaagaccg agtcctgatg aacgaagaca tcagggttcc tgaagtacgc        60
     tgtgtggttg atggcggtga agcattaggt atcatctcta tcaatgaggc tatgaataag       120
     gcaaacgaaa tgggacttga tttggttctc atctctccgg atgcaaaacc tcctgtcgca       180
     aaaatcatgg actacggtaa gtttcattac caagaagaga aaaagaaaaa agaggcgcgt       240
     aaaaagcaaa cgaaagtaga agtcaaagag attaaacttt cggtaaaaat tgcggataac       300
     gatgtcggct ataaagttaa acacgcacgc gaattcctcg aagagggaaa acacgtccat       360
     ttccgcgtat ttttgcgcgg acgtgaaatg gcacatcctg agtcggctgt tgcggtttta       420
     cagcgtgttt ggccgatggt tgaagatatc ggtacgatgt ataaagcccc gcaaatggaa       480
     ggtcgttatt gcaatatgat gatccatccg aaaaaagacg ataaaaaata a                531
//

If you have problems or comments...

PBIL Back to PBIL home page