(data stored in ACNUC7421 zone)

EMBL: CP002355.PE109

CP002355.PE109       Location/Qualifiers
FT   CDS_pept        106575..106769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0109"
FT                   /product="LSU ribosomal protein L35P"
FT                   /note="InterPro IPR018265: IPR001706: IPR021137; KEGG:
FT                   tdn:Suden_0206 50S ribosomal protein L35; PFAM: Ribosomal
FT                   protein L35; SPTR: 50S ribosomal protein L35; TIGRFAM:
FT                   ribosomal protein L35; PFAM: Ribosomal protein L35;
FT                   TIGRFAM: ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32777"
FT                   /db_xref="GOA:E4TWU6"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU6"
FT                   /protein_id="ADR32777.1"
FT                   /translation="MPKMKSVKGAVKRFKVKKNGTIKRGSAFRSHILTKQDAGTRRKQN
FT                   APKVVANVDVKAIKKMIVG"
     atgccaaaaa tgaaatcggt taaaggggcg gtaaaacgct tcaaagtgaa gaaaaacggc        60
     acaatcaaac gtggtagcgc attccgcagc catattttga caaaacaaga tgctgggact       120
     cgacgtaagc aaaatgcacc aaaagtggtt gctaacgtag acgttaaagc tatcaaaaag       180
     atgatcgtag gctaa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page