(data stored in ACNUC7421 zone)

EMBL: CP002355.PE11

CP002355.PE11        Location/Qualifiers
FT   CDS_pept        complement(12443..13117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0011"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789: IPR001867; KEGG: tdn:Suden_1559
FT                   two component transcriptional regulator; PFAM: response
FT                   regulator receiver; transcriptional regulator
FT                   domain-containing protein; SMART: response regulator
FT                   receiver; SPTR: Two component transcriptional regulator,
FT                   winged helix family; PFAM: Response regulator receiver
FT                   domain; Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32679"
FT                   /db_xref="GOA:E4TW63"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW63"
FT                   /protein_id="ADR32679.1"
FT                   /translation="MNALILIVEDEQDILELMEYHLTKEGFETIGFLNTKHVNNALEEE
FT                   NVDLILMDRNLPGAEGSEFVESLRKRGMQTPVIFVSAKNKDEDIEQGFERGGDDYIAKP
FT                   FSMKELILRVKAVLRRTKKLSNEGNLSYRDISLNLAARTVFIESNPIELTKLEFDLLHA
FT                   LIVNENVVLERDYLLENVWGGDEVYQDRTVNVAINRLKEKIDPDKSKEYIKTVRGVGYT
FT                   LC"
     gtgaatgcgt tgatactgat tgtcgaagac gaacaggata ttttggaact tatggaatat        60
     cacctcacga aagaggggtt tgaaaccata ggatttctca ataccaaaca cgttaacaat       120
     gcccttgaag aagaaaatgt ggatttgatc cttatggatc ggaatcttcc gggtgcagaa       180
     ggaagcgagt ttgtcgagtc attgcgaaaa cggggaatgc agacgccggt tattttcgtg       240
     agtgcaaaga acaaagacga agatatcgaa cagggatttg aacggggtgg ggacgattac       300
     atcgccaaac ctttcagtat gaaagagttg atcctgcggg ttaaagcggt attgcgccgt       360
     actaaaaagc tttcgaatga agggaatctg tcctaccgtg atatctcgct caatctggct       420
     gctagaacgg tatttatcga aagcaatccg atagaactca ccaaactcga attcgatctc       480
     ctgcatgctc ttatcgtgaa tgaaaatgtc gttcttgagc gtgattatct tctcgaaaac       540
     gtatggggcg gtgacgaagt gtatcaagac cgcaccgtca acgttgcgat taaccgcctc       600
     aaagaaaaaa tcgatcccga taagtccaaa gaatatatca aaacggtacg gggagtcggt       660
     tacacactgt gctaa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page