(data stored in ACNUC7421 zone)

EMBL: CP002355.PE110

CP002355.PE110       Location/Qualifiers
FT   CDS_pept        106863..107216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0110"
FT                   /product="LSU ribosomal protein L20P"
FT                   /note="COGs: COG0292 Ribosomal protein L20; InterPro
FT                   IPR005813; KEGG: ccv:CCV52592_0347 50S ribosomal protein
FT                   L20; PFAM: ribosomal protein L20; SPTR: 50S ribosomal
FT                   protein L20; TIGRFAM: ribosomal protein L20; PFAM:
FT                   Ribosomal protein L20; TIGRFAM: ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32778"
FT                   /db_xref="GOA:E4TWU7"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU7"
FT                   /protein_id="ADR32778.1"
FT                   /translation="MPRVKTGVVRRRRHKKVLKLARGFYSARHKHFRKAKEQLERSLVY
FT                   AFRDRKQKKREFRKLWIIRINAACRLNGMSYSVFMNGLKRANIELDRKILADMAMNDAA
FT                   AFTALTTQAKAAL"
     atgccaagag taaaaactgg tgtcgtaaga cgcagacgtc ataaaaaagt attgaaactc        60
     gcacgtggtt tctacagtgc acgccacaaa catttccgta aagcgaaaga gcaactcgag       120
     cgctcactcg tatacgcgtt ccgtgaccgt aaacagaaaa aacgtgaatt ccgtaaattg       180
     tggattatcc gtatcaatgc ggcatgccgc ctaaacggaa tgagctattc agtattcatg       240
     aacggcctta aacgtgccaa catcgaactt gatcgcaaaa tccttgctga catggctatg       300
     aacgatgcag cggcatttac tgccctcact actcaagcta aagcagcact ctaa             354
//

If you have problems or comments...

PBIL Back to PBIL home page