(data stored in ACNUC7421 zone)

EMBL: CP002355.PE111

CP002355.PE111       Location/Qualifiers
FT   CDS_pept        complement(107305..107547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0111"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvy:VVA1079 membrane-fusion protein; SPTR:
FT                   Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32779"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU8"
FT                   /protein_id="ADR32779.1"
FT                   /translation="MKKNLFFGLIAAALLLSGCADKQISINGMICPAGKTEDRIMADFQ
FT                   ECRYYDLKAAGEASKAPITVECQKCLESKGYKIEQ"
     atgaaaaaaa acctattttt cggcctaatc gccgctgcac ttctcctaag cggatgcgct        60
     gataaacaaa tttcgatcaa cggaatgatt tgtccggcag gtaaaacgga agaccggatt       120
     atggcggatt ttcaagaatg ccgctattac gatttaaaag ccgcaggtga agcatcaaaa       180
     gctccgatta ccgtagagtg tcaaaaatgt cttgagagta aagggtataa aatcgagcaa       240
     taa                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page