(data stored in ACNUC7421 zone)

EMBL: CP002355.PE113

CP002355.PE113       Location/Qualifiers
FT   CDS_pept        complement(108348..110432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0113"
FT                   /product="RNA-metabolising metallo-beta-lactamase"
FT                   /note="COGs: COG0595 hydrolase of the
FT                   metallo-beta-lactamase superfamily; InterPro IPR001587:
FT                   IPR004613: IPR011108; KEGG: tdn:Suden_2089 hypothetical
FT                   protein; PFAM: RNA-metabolising metallo-beta-lactamase;
FT                   SPTR: Metallo-beta-lactamase family protein; PFAM:
FT                   Metallo-beta-lactamase superfamily; RNA-metabolising
FT                   metallo-beta-lactamase; TIGRFAM: conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32781"
FT                   /db_xref="GOA:E4TWV0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV0"
FT                   /protein_id="ADR32781.1"
FT                   /translation="MSEEQPGSQTQPQGENRQRRNNRRPFRSRNNNRPEGAEGNTTERP
FT                   NTEPREDSRPPRQDNRPPRQDNRPPRQDNRPPRTDRPEGSDANATDAEPARSGRDRGRG
FT                   GRRGSPSTPIDNNLRDFVVKNQDAHKNRLNPHYKLDLNNNDKVRITPLGGLGEIGGNIT
FT                   VIETENEAIIIDIGMSFPDEEMHGVDILVPDFTYLREIRKKIVAVIITHAHEDHIGGVP
FT                   YFFKEMQFPIYGTPLPLAMIGNKFDEHHMRDFRRYFNPIVKRIPYKIGNDFEIEWMHMT
FT                   HSIIDSSSLAITTKAGTIIHTGDFKIDHTPVDGYTADLHRLAHYGEKGVLCLLSDSTNS
FT                   YNKEWTPSELTVAPGFDRIFSKAEGRVIMSTFSSNIHRVYQAILTGIKYNRKVCVIGRS
FT                   MERNLEVCMQYDYIKLPKNIFIDAEEANRMSDKDVLIVTTGSQGEPSSALFRMAIGEHR
FT                   HIKIKPTDLIVLSARAIPGNEGSISGMLNYLQRAGARVANDRDIHVSGHASMEEQKLML
FT                   RLTNPKFFLPVHGEYNHIMKHKETAVTCGVPERNILLMSDGDSIEVNTKMMRKAKTVKT
FT                   GKTYIDNQNNHQIEDDIIIDRQKMASEGMVMLVAQVSAAESRLLSKPLVTSFGIVADRH
FT                   DKAFALEMEDVLEHFLINLKPGLIENPKALENDLRQVVRKHIYRKMKKYPLIVPHVFVM
FT                   "
     atgtccgaag aacaaccagg atcacaaaca cagccgcaag gcgaaaatcg tcaacgccga        60
     aataaccgtc gaccgtttcg cagccgaaac aacaaccgcc ccgaaggtgc agaggggaat       120
     acgactgagc gtccaaacac agagccgcgg gaagacagcc gccctcctcg tcaggataac       180
     cgccctcccc gccaggacaa ccgccctcct cgtcaggaca acagacctcc tcgtacagac       240
     cgtccggaag gatccgatgc aaacgcaacc gatgccgaac ctgcgcgctc aggccgtgat       300
     cgtggacgcg gcggccgtcg cggaagtcct agcacaccga ttgataacaa tcttcgcgat       360
     tttgttgtca aaaaccaaga tgcccataaa aaccgtctca atccccacta taaactcgat       420
     cttaataata atgacaaagt tcgtatcaca ccgctgggcg gtctcggtga gatcggcgga       480
     aatatcacgg tcatcgaaac ggaaaacgaa gcgattatca ttgatatcgg gatgagcttt       540
     ccggacgaag agatgcacgg agtcgatatt ctcgtccctg acttcaccta cttgcgcgaa       600
     atccgcaaaa aaatcgttgc cgtcatcatt acccatgccc atgaagacca tatcggaggg       660
     gtaccgtatt tcttcaaaga gatgcaattc ccgatttacg gaacgccgtt gcctctggca       720
     atgatcggaa acaaattcga cgaacatcat atgcgcgatt tccgccgcta cttcaatccg       780
     attgttaaac ggataccgta caaaatcgga aacgatttcg aaatcgaatg gatgcacatg       840
     acccactcga tcattgactc ttcctcattg gcgatcacga ctaaagcggg aactattatc       900
     catacgggcg attttaaaat cgaccatact ccggtagacg gctacacggc tgacttgcac       960
     cgattggctc actacggtga aaaaggggtt ctttgtctcc tctcagactc cactaactct      1020
     tataacaaag agtggactcc gagcgaactg accgtagcac cgggatttga ccgtatcttc      1080
     tcgaaagccg aagggcgtgt catcatgtca acgttcagtt caaacattca ccgtgtatat      1140
     caagcgattt tgaccggtat aaaatacaac cgtaaagtat gtgttatcgg acgatcaatg      1200
     gagcggaatc tcgaagtatg tatgcaatac gattacatta aacttcctaa aaacatcttc      1260
     atcgatgccg aagaggcaaa ccgcatgagc gacaaagacg tcctcatcgt cacaaccgga      1320
     agtcaggggg aaccgagttc ggccctcttc cgtatggcga tcggcgagca ccgccatatc      1380
     aagatcaagc cgaccgattt gatcgtcctc tccgcacgtg cgattccggg gaatgaagga      1440
     tcgatttcag ggatgctcaa ctatctccaa cgagcaggcg ctcgtgtagc caatgacaga      1500
     gatatccacg tttcgggaca cgcgagtatg gaagaacaaa agttgatgct tcgtcttacc      1560
     aatcctaaat tcttcctccc tgttcacggt gaatacaatc acattatgaa gcataaagag      1620
     acggcggtta cctgtggagt tccggaacgt aatattctcc taatgtctga cggtgacagt      1680
     atcgaagtga acaccaaaat gatgcgcaaa gccaaaaccg tcaaaacagg taaaacgtac      1740
     atcgataacc aaaataatca ccaaatcgaa gacgacatca ttatcgatcg tcaaaaaatg      1800
     gcgagcgagg ggatggttat gctggtcgct caggtcagtg ccgcagaatc gcgacttctg      1860
     tccaaacctc ttgttaccag ctttggtatc gtagccgatc gccatgacaa agcgtttgca      1920
     ctagagatgg aagatgtgtt agagcacttc ttgatcaatc tcaaaccggg gctaatcgag      1980
     aatccgaaag cgttggaaaa cgatcttcgt caggtagtac gcaaacatat ctaccgcaaa      2040
     atgaaaaaat atccgcttat cgttccgcac gttttcgtga tgtaa                      2085
//

If you have problems or comments...

PBIL Back to PBIL home page