(data stored in ACNUC7421 zone)

EMBL: CP002355.PE114

CP002355.PE114       Location/Qualifiers
FT   CDS_pept        complement(110507..111286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0114"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG0030 Dimethyladenosine transferase (rRNA
FT                   methylation); InterPro IPR011530: IPR001737: IPR020598;
FT                   KEGG: tdn:Suden_2090 dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; SMART:
FT                   Ribosomal RNA adenine methylase transferase-like; SPTR:
FT                   Ribosomal RNA small subunit methyltransferase A; TIGRFAM:
FT                   dimethyladenosine transferase; PFAM: Ribosomal RNA adenine
FT                   dimethylase; TIGRFAM: dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32782"
FT                   /db_xref="GOA:E4TWV1"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV1"
FT                   /protein_id="ADR32782.1"
FT                   /translation="MQKDRAAIAKKKFGQNFLKDEAVLAQIIQSMPDTPHRIAEIGPGL
FT                   GDLTKYLVDVKSVTAFEVDTDLCKHLTHQFADAIATNALTLRCGDVLEHWKSELLDEPY
FT                   DLVANLPYYIATNIILKALADPACRNLLVMIQREVAEKFSAAPGERAFGALSVIAQSVG
FT                   EAEIVLHVPPTAFEPAPKVDSCVLLISKRTNRNDEGFEDFLRTAFTQPRKTLHKNLSSR
FT                   YDGTVLSQAFETLELERSIRPHQLDTSDFHRLYTLIK"
     atgcaaaaag accgtgccgc tattgccaag aaaaagtttg gccaaaattt tttaaaagac        60
     gaagctgttt tagcccaaat catccaatcg atgcccgata cgcctcaccg tatcgcagaa       120
     atcgggcctg gattaggtga tttaactaag tatttagttg atgtcaaaag tgttaccgct       180
     tttgaggtcg ataccgactt gtgcaagcat ttgacgcacc aatttgccga tgctatcgct       240
     accaacgctc ttactctccg atgcggagat gtgctagagc attggaagag tgagcttttg       300
     gatgaaccgt acgatttagt ggcgaatttg ccctattaca tcgctacgaa tatcatcctc       360
     aaagccctcg ccgatccggc gtgccgaaac ttgcttgtca tgatacagcg tgaagtggcg       420
     gagaaattct ctgccgcacc cggagagaga gcttttggag cgctcagtgt aattgcgcag       480
     agtgtcggag aggcggagat cgttttacac gttcccccta ccgcattcga gcctgctccc       540
     aaagtcgatt cgtgcgtact gctcatttct aaacgtacga accgtaatga tgaagggttt       600
     gaagactttt tacgaacggc ctttacacag ccccgtaaaa ccctccacaa aaatctctcc       660
     tcacgctatg atggaaccgt tctgtcccaa gcctttgaaa cgcttgagtt ggaacgctct       720
     atccgacctc atcagcttga cacctctgac tttcaccggc tctacaccct tataaaataa       780
//

If you have problems or comments...

PBIL Back to PBIL home page