(data stored in ACNUC7421 zone)

EMBL: CP002355.PE115

CP002355.PE115       Location/Qualifiers
FT   CDS_pept        111443..112204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0115"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="COGs: COG0107 Imidazoleglycerol-phosphate synthase;
FT                   InterPro IPR004651: IPR006062; KEGG: tdn:Suden_2091
FT                   imidazole glycerol phosphate synthase subunit HisF; PFAM:
FT                   histidine biosynthesis protein; SPTR: Imidazole glycerol
FT                   phosphate synthase subunit hisF; TIGRFAM: imidazoleglycerol
FT                   phosphate synthase, cyclase subunit; PFAM: Histidine
FT                   biosynthesis protein; TIGRFAM: imidazoleglycerol phosphate
FT                   synthase, cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32783"
FT                   /db_xref="GOA:E4TWV2"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV2"
FT                   /protein_id="ADR32783.1"
FT                   /translation="MDNFFAKRIIPCLDVKDGRVVKGVNFVGLKDAGDPVEVAKRYNEE
FT                   GADELTFLDITASHEERDTIVHIVEQVAKEVFIPLTVGGGIRKLDDIYRLLAVGCDKVS
FT                   VNSAAIKRPELIDEGAKRFGSQCIVVAIDVKRTGNQYNVYLNGGRVDTGINALEWAKEV
FT                   VDRGAGEILLTSMDADGTKAGFDLSITEQISRAVNVPVIASGGAGTMEHIKEAFEHGAD
FT                   AALAASIFHYKEIDIMDLKRYLSANGIPVRL"
     atggataatt tttttgcaaa acggatcatt ccgtgcctcg atgttaaaga cggacgcgtt        60
     gtaaaagggg tcaatttcgt cggcctcaaa gatgcgggag accctgttga agtggcaaaa       120
     cgctataacg aagaaggtgc ggacgagctc acttttttag atattaccgc ttcgcacgaa       180
     gagcgtgaca cgatcgtcca tatcgtagag caggtagcaa aggaagtatt tatccctctc       240
     accgtagggg gaggaatccg caaactcgac gatatttatc gtcttctcgc cgtcggatgc       300
     gacaaagtga gtgtcaattc tgccgcgata aaacgtccgg aactgatcga tgagggggca       360
     aagcgattcg gttcacaatg tattgtcgtg gcgatcgatg tgaagcgtac cggcaatcaa       420
     tataacgtct atctaaacgg cggacgtgtc gatactggga tcaatgcact ggaatgggct       480
     aaagaggtcg tagatcgagg ggcgggagag atattgctta cctcgatgga tgctgacggt       540
     accaaagcgg gatttgatct atcgatcacg gaacagatca gccgcgccgt caatgtaccc       600
     gttatcgcca gcggcggtgc ggggacgatg gaacatatta aagaggcgtt tgaacacggt       660
     gccgatgcgg cactggcggc gagtattttc cactacaaag agatcgacat tatggatctc       720
     aaacgctacc tgtcggctaa cgggattccg gtacgattat ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page