(data stored in ACNUC7421 zone)

EMBL: CP002355.PE117

CP002355.PE117       Location/Qualifiers
FT   CDS_pept        112730..113794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0117"
FT                   /product="23S rRNA m(2)A-2503 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG0820 Fe-S-cluster redox enzyme; InterPro
FT                   IPR004383: IPR007197; KEGG: tdn:Suden_2093 ribosomal RNA
FT                   large subunit methyltransferase N; PFAM: Radical SAM domain
FT                   protein; SPTR: Ribosomal RNA large subunit
FT                   methyltransferase N; TIGRFAM: radical SAM enzyme, Cfr
FT                   family; PFAM: Radical SAM superfamily; TIGRFAM: radical SAM
FT                   enzyme, Cfr family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32785"
FT                   /db_xref="GOA:E4TWV4"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV4"
FT                   /protein_id="ADR32785.1"
FT                   /translation="MGKLCILDYTKAELAGMVKPSFRAKQIWGWIYHQYATSFETMQNL
FT                   PKTMREELAQTYEIMPLKIARKECSTDGTIKYLFELSDGKTVETVWLKMKDESIDEEGN
FT                   IEHEARYTVCVSTQVGCKVGCSFCLTAKGGFTRDLTAGEIVAQVLAVKMDNNLAAHRRL
FT                   NIVYMGMGEPLDNLDNLAKAITILKDEEGLSISGKRQTVSTSGLSTKIDKLGEMDLGVH
FT                   IAISLHAVDDELRTELIPMNKAYNIASIIDAVKRFPIDTRKRVMFEYLVIKNKNDDLGS
FT                   AKKLVKLLHGIKAKVNLIYFNPYPGSDYQRPSREDMVAFQEYLIKHGVLCTIRDSKGLD
FT                   ISAACGQLKEKSLT"
     gtgggtaagc tgtgcattct agattatacc aaagctgaac tcgccggtat ggtgaaaccc        60
     tcgttccgcg ccaaacagat atggggatgg atttaccatc aatacgccac cagttttgag       120
     acgatgcaaa atcttcccaa gacgatgcgc gaagagctgg ctcaaacgta tgagattatg       180
     ccgcttaaaa ttgcccgaaa ggaatgctct accgacggaa cgattaaata tcttttcgag       240
     ctgagtgacg gtaaaacggt tgagacggtt tggctcaaaa tgaaagacga aagcatcgat       300
     gaagagggaa atatcgaaca tgaagcgcga tacaccgtct gtgtctcgac acaagtgggg       360
     tgcaaagtgg gatgttcgtt ttgtctgacg gcaaaagggg gatttacccg tgatctaacg       420
     gcaggcgaaa ttgtcgctca ggtgttggcc gttaagatgg ataacaatct cgcagcgcat       480
     cgccgtctca atatcgtcta tatggggatg ggggagccgt tggataattt ggacaattta       540
     gccaaagcga tcacgatact caaagacgaa gaggggcttt ctatttcggg caagcgtcag       600
     acggtctcga cgagcgggct gagtaccaag atcgataagc tcggagagat ggatttaggg       660
     gttcatatcg cgatcagcct ccatgccgtt gatgatgaac ttcgtaccga actgatcccg       720
     atgaacaaag cgtacaatat cgcttcaatc atcgatgcgg tcaagcgttt tccgatcgat       780
     acccgaaaac gggtgatgtt tgaatatctt gtcattaaaa ataaaaatga tgatttgggc       840
     tcggcgaaaa aactggtcaa gcttcttcac ggtattaaag ccaaggtcaa tttgatctat       900
     tttaatccct atcccgggtc ggattatcaa cgcccgtctc gtgaggatat ggttgcattt       960
     caagagtatt tgataaagca cggtgtgctg tgcacgatcc gagactccaa gggattggat      1020
     atcagtgcgg cctgcgggca gttaaaagag aaatcgttaa cttaa                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page