(data stored in ACNUC7421 zone)

EMBL: CP002355.PE118

CP002355.PE118       Location/Qualifiers
FT   CDS_pept        complement(113964..114659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0118"
FT                   /product="Nucleoside-specific channel-forming protein, Tsx"
FT                   /note="COGs: COG3248 Nucleoside-binding outer membrane
FT                   protein; InterPro IPR018013; KEGG: afw:Anae109_0194
FT                   hypothetical protein; PFAM: Nucleoside-specific
FT                   channel-forming protein, Tsx-like; SPTR: Putative
FT                   uncharacterized protein; PFAM: Nucleoside-specific
FT                   channel-forming protein, Tsx"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32786"
FT                   /db_xref="GOA:E4TWV5"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV5"
FT                   /protein_id="ADR32786.1"
FT                   /translation="MKRLLFASLITAAQLSAFSATNLQYLYGKFEGPTFLDTQSGNKHT
FT                   ITAEHYRTWEYGDLFAFADYVYAPNGLRFSGDKNDLYGEISPRISFNKIAGIPVSDGFI
FT                   KEWYAAFQYNGSDTYHAWLYGFGTDMNVPGFSVFGLNLYRKVQNIGNETYQLSANYYAP
FT                   LGEKWHFEGFTDWTTCDFLSQNQLLFNLNSVFGIKEGKLEIGTEWHYYHENSYRNDNDV
FT                   FQAMLKYSW"
     atgaaacgct tactcttcgc tagtcttatc accgctgccc agctcagcgc attttcggct        60
     accaatctcc aatatctcta cggcaaattt gaagggccga catttctcga tacccaaagc       120
     ggcaacaaac atacgataac ggcggaacat tatcgtacct gggagtacgg tgatctgttt       180
     gcatttgccg attatgtcta tgccccgaac ggactccgtt tcagcggaga taaaaacgat       240
     ctctacggcg agatttctcc ccgtatcagc ttcaataaaa ttgccggaat tcctgtatcg       300
     gacggattta ttaaagaatg gtatgcggct tttcaatata acggatcgga tacctatcat       360
     gcatggcttt acggattcgg caccgatatg aatgtaccgg ggttcagtgt tttcggactc       420
     aatctctatc gaaaagtcca aaatatcgga aatgagacct atcagctctc cgccaactat       480
     tacgcgccgc tcggtgaaaa atggcatttt gaggggttca cagattggac gacatgtgat       540
     tttttgagcc aaaaccaatt gttgttcaat ctcaattcag tctttggaat taaagagggg       600
     aagttggaaa tagggacgga atggcattac taccatgaaa acagctatcg aaacgataat       660
     gatgtctttc aggcgatgct caaatacagc tggtga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page