(data stored in ACNUC7421 zone)

EMBL: CP002355.PE119

CP002355.PE119       Location/Qualifiers
FT   CDS_pept        complement(114637..115476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0119"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR010916: IPR016047; KEGG:
FT                   cju:C8J_1178 peptidase, M23/M37 family; PFAM: Peptidase
FT                   M23; SPTR: Peptidase; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32787"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV6"
FT                   /protein_id="ADR32787.1"
FT                   /translation="MRFLLILWLGFLALWGAEGFNGKSLIIPLPSPSGTVIMSDRNISV
FT                   LLHPADKTKGIAVIPIDYYTPAGDINLTWIAPGNESFFSIHIQEADYPTETLSVDPALV
FT                   TPPPEAMEQIAAEKAQAEAIYGHFTPIRYWNKAFVKPIDSNITSEYGSARTYNGSLKSY
FT                   HGGVDFRARTPIPIVAANDGIVVLVQERYYSGGTIIIDHGEGIYSCYFHLSRFDVNVGD
FT                   RIERGQPIALSGESGRITGPHLHFGMMVHGIQSDPLDLISQFNALISKDTDETLTLR"
     atgcgatttt tgctcatttt atggctcggt tttttagccc tttggggtgc tgaaggattt        60
     aacgggaaaa gtctcatcat acccctacct tcaccttcgg gaaccgtgat tatgagcgat       120
     cgcaatataa gcgtcctcct tcatcctgcc gataaaacca aagggatcgc cgttataccg       180
     atcgattact acacccctgc gggagacatc aacctcacct ggattgcacc gggaaacgag       240
     agctttttct caatccatat ccaagaggcc gactatccta ccgaaacact cagtgtcgat       300
     cccgctttgg tgactccccc tccggaagcg atggagcaga ttgcggctga aaaagcgcag       360
     gcagaagcga tctacgggca ctttacaccg atccgctatt ggaacaaagc gttcgttaag       420
     cccatagact ccaatatcac cagcgaatac ggctccgccc gcacctacaa cggaagtctg       480
     aaaagctacc atggaggggt cgattttcgt gcccgaacgc cgatccccat tgtcgcggca       540
     aacgacggga tcgtcgtctt ggtacaggaa cgctattatt ccggcggaac aatcattatc       600
     gatcacggcg aagggatata ttcatgctat tttcacctca gccgattcga tgtcaatgtc       660
     ggtgatcgta ttgagcgtgg acaaccgatc gcactcagcg gtgagagcgg acggattacg       720
     ggtccgcatc ttcatttcgg gatgatggtt cacggcatac agtctgatcc gcttgacctt       780
     atttcccaat ttaatgccct tatttcaaag gataccgatg aaacgcttac tcttcgctag       840
//

If you have problems or comments...

PBIL Back to PBIL home page