(data stored in ACNUC7421 zone)

EMBL: CP002355.PE12

CP002355.PE12        Location/Qualifiers
FT   CDS_pept        complement(13251..13922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0012"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="COGs: COG0704 Phosphate uptake regulator; InterPro
FT                   IPR008170; KEGG: tdn:Suden_1888 phosphate uptake
FT                   regulator-like; PFAM: PhoU family protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: PhoU domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32680"
FT                   /db_xref="GOA:E4TW64"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW64"
FT                   /protein_id="ADR32680.1"
FT                   /translation="MLPRYENKLNEIRGMISVMLSQIIQSSEETLKAFETDNAELYEIS
FT                   RTYIKNIQVDANKIDNEIIKTFALFGPEADELRLLVAYLKMTNEIDRIGDGLKKYSKRL
FT                   HDHCMGGCDMSVLTNAIVQLHKTTINALQYISECLNNIDSCDADDTYRKVMVEESKNDD
FT                   LFSLMEKELLNLIIDANELAVEYVRVLGTLRKLERIGDRTVNIASLMLYAQKGGELNLH
FT                   N"
     atgctaccac gctatgaaaa caaactcaat gaaattcggg gaatgatctc cgtaatgctc        60
     tctcagatta ttcaatcaag cgaagagacg ctcaaagcat ttgaaaccga caatgcagaa       120
     ctgtacgaga tctcacgtac ctatattaaa aatattcaag tggatgccaa caaaattgat       180
     aacgaaatta ttaaaacatt cgcccttttc ggtccagaag ccgatgagtt acgattgctt       240
     gtcgcatatt tgaaaatgac caatgaaatt gaccgtatcg gcgacggact caaaaaatac       300
     agcaaacgtt tgcatgacca ctgtatggga ggatgcgaca tgagcgtttt gaccaatgcg       360
     atcgttcagt tgcataaaac aacgatcaat gcgttacaat acatttcaga atgtttaaat       420
     aacatcgact catgcgacgc ggacgatacc tatcgtaaag tgatggtcga agagtccaaa       480
     aatgacgatc tattttcttt aatggagaaa gagcttctaa acctgatcat cgacgcgaat       540
     gaacttgccg tcgaatatgt tagagtgtta ggaacattac gcaaattaga gcgaatcggt       600
     gatcgtacgg tcaatatagc ttcgttgatg ctctatgcac aaaagggcgg cgagttaaac       660
     ttgcacaatt ag                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page