(data stored in ACNUC7421 zone)

EMBL: CP002355.PE123

CP002355.PE123       Location/Qualifiers
FT   CDS_pept        120229..120444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDB_G0285449 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32791"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW0"
FT                   /protein_id="ADR32791.1"
FT                   /translation="MVIVNSSLQSPSPMESTQVAKSALQTNKSLDDAIIEFNTQEVQKN
FT                   SSRFQENLSVMAAQMTGKGLNLDIRG"
     atggttatag tgaatagttc tctccagtct ccatcaccga tggaatcgac tcaagttgca        60
     aaatctgctc ttcagacaaa caagtctctc gatgatgcga ttatagagtt caatacacaa       120
     gaagtgcaaa aaaatagcag cagatttcag gaaaatcttt ccgttatggc agctcaaatg       180
     acaggcaagg gattgaattt ggatattaga ggatag                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page