(data stored in ACNUC7421 zone)

EMBL: CP002355.PE124

CP002355.PE124       Location/Qualifiers
FT   CDS_pept        121869..122678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0125"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0600 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system permease component; InterPro IPR000515;
FT                   KEGG: cja:CJA_2719 ABC transporter, permease protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: ABC transporter, permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32792"
FT                   /db_xref="GOA:E4TWW1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW1"
FT                   /protein_id="ADR32792.1"
FT                   /translation="MRLINLNAGRFSPLLKILPFVILGLVYWIAADARHALNPEDKLLP
FT                   TFEAIGEAVKTMVMEPDELTEEPILYTDTVASLNRIAQGLGIATAVGLILGIVQGTLPL
FT                   FRSLLSPFSAAVSLIPPIAILPILLIIFGLEESAKVALIAIGVAPFLIRDTQQRSMELS
FT                   EELLIKVQTLGASTWQIILRVVLPHVMPRLLDALRLSLGAAWLFLITAEAIASSEGLGY
FT                   RIFLMRRYMEMDVILPYVAWITLLAFLMDWILAVIIRRAFPWYRKEK"
     atgcgtttga tcaatctgaa tgctggacgg ttttcaccgc ttttaaaaat attgccgttt        60
     gtgattctcg gattggtcta ttggattgct gcagatgcgc gtcacgccct aaatccggaa       120
     gacaagcttc ttccgacatt tgaagcgatc ggcgaagcgg taaaaacgat ggtcatggaa       180
     ccggatgaat taaccgaaga gccgattttg tacaccgata cggttgcgag tctgaaccgg       240
     attgcacaag gattggggat tgctacggct gtcggcctga tattggggat cgtacagggg       300
     acgttacctc tgtttcgttc acttctttcc ccgttttcgg cagcagtatc gttaataccg       360
     ccgatcgcga tattgccaat actgttgatc attttcgggc tggaagaatc ggctaaagtg       420
     gcgctgatcg ctatcggtgt ggctccgttt ctgatccgtg atacgcagca gcgttccatg       480
     gaactttccg aagagctctt gatcaaggtg caaaccttgg gggcatcgac atggcagatc       540
     attctgcgtg tcgttttacc ccatgttatg ccacgtctgc tggatgcgct cagactttca       600
     ctgggtgcgg catggctttt tctcattacg gcggaagcga tcgcgtcttc ggaaggtttg       660
     ggataccgta tctttttgat gcgccgctac atggagatgg atgtcatttt accgtacgtc       720
     gcgtggatca cgctgctggc atttcttatg gactggatac ttgcggtgat cattcgcaga       780
     gcatttccat ggtatcggaa ggagaaataa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page