(data stored in ACNUC7421 zone)

EMBL: CP002355.PE125

CP002355.PE125       Location/Qualifiers
FT   CDS_pept        122678..123454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0126"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1116 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system ATPase component; InterPro IPR017871:
FT                   IPR003439: IPR003593; KEGG: wsu:WS1112 ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: ABC TRANSPORTER, ATP-BINDING PROTEIN;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32793"
FT                   /db_xref="GOA:E4TWW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW2"
FT                   /protein_id="ADR32793.1"
FT                   /translation="MSYLQIRNVWKTYDDNVILEKLNFTIEKGEFCTLIGPSGCGKSTF
FT                   LRMLLGKESPTRGTILLEGEPLSNEPGSDRGVVFQKYTLFPHLRALENVMLGLEMEHSA
FT                   FLGKAFGSARRRIKEEAMEMIKAVGLEQSAHKYPSELSGGMQQRLSIAQALVKKPKILL
FT                   LDEPFGALDPGSRSDMQELVHGLWQTYGLTAFMVTHDVKEAFELGTRLLVFDKVRNDPH
FT                   SPNAYGATVVNDIKLDKNKRKNKGEGHVDHDETIIA"
     atgagttatt tgcaaatccg taatgtatgg aaaacctacg atgataacgt cattcttgaa        60
     aaactcaatt tcacgatcga aaaaggggaa ttttgtaccc ttatcggacc gtcaggatgc       120
     ggaaaaagca cctttttgcg aatgctttta gggaaggaga gcccgactcg cgggacaatt       180
     ttgcttgagg gcgagccgct ctcgaatgag ccggggagcg acagaggtgt cgtatttcaa       240
     aaatacaccc tgttcccgca tctaagagca ttggaaaacg tgatgctggg actggagatg       300
     gaacactctg catttctggg caaagcgttc ggaagcgcac gccgccggat taaagaggaa       360
     gcgatggaga tgatcaaagc ggtagggttg gagcaatcgg cgcacaagta cccttctgaa       420
     ctctcaggag ggatgcagca gcgtctctct atcgctcagg ctttggtgaa aaagccgaag       480
     atattgttgc tggatgagcc gttcggcgca cttgatcctg gaagccgatc cgatatgcag       540
     gagctggttc acggattatg gcagacctac gggctgaccg catttatggt gacacatgat       600
     gtcaaagagg cttttgagct cggcaccaga ttgctggtgt ttgataaagt ccgtaacgat       660
     ccgcactcac cgaatgccta cggcgctacg gtcgtcaatg atataaaact tgataaaaat       720
     aaacgaaaaa ataaaggaga agggcatgtc gaccatgatg aaaccattat cgcctga          777
//

If you have problems or comments...

PBIL Back to PBIL home page