(data stored in ACNUC7421 zone)

EMBL: CP002355.PE126

CP002355.PE126       Location/Qualifiers
FT   CDS_pept        123432..124187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0127"
FT                   /product="urea carboxylase-associated protein 2"
FT                   /note="COGs: COG3665 conserved hypothetical protein;
FT                   InterPro IPR017792: IPR018959; KEGG: wsu:WS1113
FT                   hypothetical protein; PFAM: Domain of unknown function
FT                   DUF1989; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   urea carboxylase-associated protein 2; manually curated;
FT                   PFAM: Domain of unknown function (DUF1989); TIGRFAM: urea
FT                   carboxylase-associated protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32794"
FT                   /db_xref="InterPro:IPR017792"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW3"
FT                   /protein_id="ADR32794.1"
FT                   /translation="MMKPLSPETILFDEVLPGGGRWSKIIRKGQVLRILNTEATSGLSA
FT                   LFYNVHERTERYNAADTVKIQYNAYLKQGKALYSDMGRILMSIIEDSCETHDTVCGYTM
FT                   AADVEKLCGLGNYQAKRNCYYKNDFDNFLVEVGKYGMGRRDIMPCLNLFADAKIGERGE
FT                   LIFREDTVPAGSFIELRAEMDVLVILSNTVHVLSTNETYDVKPVNLTVYQGDAVAEDDI
FT                   CVIDSERSERAFVNTRNYMKQFTQGGGNV"
     atgatgaaac cattatcgcc tgagactatc ctctttgatg aggtactgcc gggcggagga        60
     cgctggagca agatcattcg caaaggtcag gtgcttcgaa tcctgaatac cgaagcgaca       120
     agcggccttt cggccctttt ttataacgtc catgaacgga ccgagcgcta taacgcggcc       180
     gatacggtca agattcaata taacgcgtat ctaaagcaag gcaaagcact ctattcggac       240
     atgggccgta ttttgatgtc gattattgaa gacagttgtg agacgcacga tacggtgtgc       300
     ggttatacca tggcagccga tgtcgaaaaa ctttgcggac tcggaaacta tcaggccaag       360
     cgtaattgct attacaaaaa cgattttgat aatttcctcg tggaagtagg aaaatacggg       420
     atgggacgcc gcgatatcat gccgtgtctc aaccttttcg ccgatgcgaa gatcggtgaa       480
     cgcggagaac tgatcttccg agaggacact gtgcctgcgg ggagctttat cgaactgcgt       540
     gccgagatgg atgtcctcgt aatcctgtca aataccgtgc atgtgctgag caccaatgaa       600
     acgtacgatg tcaaaccggt gaatctgacc gtctatcagg gagatgccgt ggcagaagat       660
     gatatatgtg tgattgattc ggagcgaagc gagcgcgcat ttgtcaacac cagaaattat       720
     atgaaacagt ttactcaagg aggcggaaat gtctga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page