(data stored in ACNUC7421 zone)

EMBL: CP002355.PE127

CP002355.PE127       Location/Qualifiers
FT   CDS_pept        124180..124821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0128"
FT                   /product="urea carboxylase-associated protein 1"
FT                   /note="COGs: COG3665 conserved hypothetical protein;
FT                   InterPro IPR017791: IPR018959; KEGG: wsu:WS1114
FT                   hypothetical protein; PFAM: Domain of unknown function
FT                   DUF1989; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   urea carboxylase-associated protein 1; PFAM: Domain of
FT                   unknown function (DUF1989); TIGRFAM: urea
FT                   carboxylase-associated protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32795"
FT                   /db_xref="InterPro:IPR017791"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW4"
FT                   /protein_id="ADR32795.1"
FT                   /translation="MSEMITVDLTLNEPIYDETIPAGEPWYHVVKAGEVLRIVDLEGCQ
FT                   AVDTLFYNANDVTERYSAPQTIVRQKNIFVETGTELVSNLGNTMMKVISDTCGRHDTLG
FT                   GACSAESNTVRYALDKLDMHSCRDNYLLALGQMGMDKRDLVSNINFFMNVPVEADGTLA
FT                   IIDGISTPGSTIELIALMDTLVLISNCPQLNNPCNAFNPTPVRLSIYKPF"
     atgtctgaga tgattacggt cgatttgact ttgaatgaac ctatctatga tgagacgata        60
     cctgccggag agccttggta ccatgttgtg aaagcgggcg aagtgctgcg gatcgtcgat       120
     ttggaagggt gccaggctgt ggataccctt ttttacaatg ccaatgacgt cacagaacgc       180
     tacagcgctc ctcaaaccat cgtacgacaa aagaacatct ttgtcgaaac gggtaccgaa       240
     ctcgtttcca atttgggaaa tacgatgatg aaagtgatca gcgatacctg cgggcgccac       300
     gatacactgg gcggtgcatg cagtgccgag agcaatacgg ttcgctacgc gctggataaa       360
     ctcgatatgc attcgtgccg ggacaattat cttttggcat tgggacaaat ggggatggac       420
     aagcgcgatc tcgtgagcaa tatcaatttt ttcatgaatg tgccggtcga agcggacggg       480
     acactggcca tcatagacgg gatttccacc cccggcagta cgatcgaatt gatcgcattg       540
     atggataccc tggtattgat ctcgaactgt ccgcagctta ataacccgtg caatgcgttc       600
     aatcctacac cggtaagact gagcatctat aaaccttttt aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page