(data stored in ACNUC7421 zone)

EMBL: CP002355.PE128

CP002355.PE128       Location/Qualifiers
FT   CDS_pept        124957..128556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0129"
FT                   /product="urea carboxylase"
FT                   /note="COGs: COG4770 Acetyl/propionyl-CoA carboxylase alpha
FT                   subunit; InterProIPR005479: IPR014084: IPR003778:
FT                   IPR000089: IPR 011761: IPR011764: IPR005481: IPR005482:
FT                   IPR003833; KEGG: slt:Slit_0080 UreA carboxylase; PFAM:
FT                   Allophanate hydrolase subunit 2; Carbamoyl-phosphate
FT                   synthase L chain ATP-binding; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; biotin carboxylase
FT                   domain protein; Allophanate hydrolase subunit 1;
FT                   biotin/lipoyl attachment domain-containing protein; SMART:
FT                   Allophanate hydrolase subunit 2; Allophanate hydrolase
FT                   subunit 1; SPTR: Urea carboxylase; TIGRFAM: urea
FT                   carboxylase; urea amidolyase related protein; PFAM:
FT                   Carbamoyl-phosphate synthase L chain, ATP binding domain;
FT                   Biotin carboxylase C-terminal domain; Allophanate hydrolase
FT                   subunit 2; Allophanate hydrolase subunit 1;
FT                   Carbamoyl-phosphate synthase L chain, N-terminal domain;
FT                   Biotin-requiring enzyme; TIGRFAM: urea carboxylase;
FT                   biotin-dependent carboxylase uncharacterized domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32796"
FT                   /db_xref="GOA:E4TWW5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW5"
FT                   /protein_id="ADR32796.1"
FT                   /translation="MFAKVLIANRGEIACRIIRTLKKMKIASVAVYSHADAGSLHVMMA
FT                   DEAICLGEPPAKESYLDVEKIIQAAKETGADAIHPGYGFLSENAAFSRRCAQEGIVFIG
FT                   PTPKHMEDFGLKHTARSMAKAQNVPLLPGTELLENVQEALRAAQEIGYPVMLKSTAGGG
FT                   GIGMQLCYGAEDLENGFESVGRLSKSNFSQGGIYLEKFVASARHIEVQIFGDGKGDVIA
FT                   LGERDCSLQRRNQKVIEETPAPGLSEEVRDALRSAAVNLARSASYKSAGTVEFVYDTTE
FT                   EKFYFLEVNTRLQVEHGVTEEIFGVDLVEWMILEAAGELGDVLKKSYTPSGHSIQVRVY
FT                   AEDPLKNFQPSSGVLSEVVFSENIRCETWIERGSAISPYYDPMIAKLIVHSSSRDEAIE
FT                   AMKSALSETTLYGIVTNIGYLKSVLDEEVFAKGEQTTKYLGTLNYSPAIVEVIKPGTHT
FT                   TVQSAPGRIGYWDIGVPPSGPMDSLSFRLGNRLLGNDEKAPGLEMTVTGSTLKFHFPTR
FT                   IVLTGAAMKAQLNGAEAAYWETIEISAGDILKMGIIEGAGARTYLLIDGGFDVPEYLGS
FT                   TATFTLGEFGGHAGRILQIGDQLSTHRSDEKKFQAVLDAALRPQMAKEWKIGVIYGPHG
FT                   APDFFKEEYIETFFATDWEVHYNSNRTGVRLIGPKPLWAREDGGEAGLHPSNLHDNAYA
FT                   IGTVDFTGDMPVILGPDGPSLGGFVCPVTIVGAELWKMGQLGPKDRVRFIPMTYDDAVK
FT                   MERDLEAKIAGLEGTLPSLPAPTVTNPVVAEIAANDRHDAVKIRLSGDHYILIEFGPME
FT                   LDLTLRFQVHELMRRLKADNDVRLIDLTPGIRSLQIHYESQTLSLTELLEKVKGELSRM
FT                   PATRDIIVPSRTVYLPLSWDDPSTKLAIEKYMQSVRDDAPWCPSNIEFIRRMNGLNGIE
FT                   DVQNILFEAEYLIMGLGDVYLGAPVAVPVDPRHRLVTTKYNPARTWTPENAVGIGGTYM
FT                   CVYGMEGPGGYQFVGRTVQMWNRYKSTTDFKLGKPWLLEFFDRIRFYPVSQNELAQMRK
FT                   DFINGTFSLRIEEGEFSLAEYLEFLETNRESIDAFKTIQQESFNAERQRWEASGISAYV
FT                   SETLETDDESDFAEIPEGCEAVSSFLSGNVWEISVKAGDTVREGDTLVIIEAMKSEVMI
FT                   ESPVAGEVVEVLCVQGDTVHTGHTLVIIKTEGV"
     atgtttgcta aagtactgat agctaaccgt ggagagatag cgtgccgtat tatccgtact        60
     ctcaagaaaa tgaagatcgc ttctgtcgcg gtctattcgc atgccgatgc cggatcactt       120
     catgtgatga tggcggatga agcgatatgt ttgggggagc cgcctgcaaa agagagttat       180
     ctggatgtag agaaaattat ccaagcggcg aaagagacgg gtgccgatgc gattcatccc       240
     ggatacggtt ttttgagtga aaatgcagca ttctcacgtc gatgtgcgca agaggggatc       300
     gtgtttatcg gaccgacacc gaagcatatg gaagattttg gactgaaaca taccgcccgt       360
     tctatggcaa aagctcaaaa tgttccgctt ttaccgggta ccgagcttct tgaaaatgtg       420
     caggaagcat tgcgtgccgc tcaagagatc ggctatccgg tcatgctcaa aagtacggcc       480
     ggtggcgggg gaatcggaat gcagctgtgc tacggtgccg aagatcttga aaacggtttc       540
     gaatcggtcg gccgtctcag caagagcaac ttttcgcaag gggggatcta cctcgaaaaa       600
     ttcgtagcct ctgcacgcca catcgaggta cagatattcg gtgacggaaa aggggatgtg       660
     atcgctttgg gtgagcggga ctgctcgctt cagcgccgta accaaaaagt gatcgaagag       720
     acaccggccc caggattatc cgaagaggtt cgtgatgcat tacgcagtgc agcagtcaat       780
     ttggcccgtt cggcatcgta taaatcggcc ggaacagtag agttcgtcta cgatacgacg       840
     gaagaaaagt tctattttct ggaagtgaat acaagattac aggtcgaaca cggggtaacc       900
     gaagagatat tcggagtaga tttggtcgag tggatgatac ttgaagctgc cggagagctg       960
     ggcgatgtgc tgaaaaaaag ctatacgccg agcggacact cgattcaggt gagggtttat      1020
     gcggaagatc cgttgaaaaa ctttcaaccg agttcggggg tactcagtga agttgttttt      1080
     tcggaaaata tccgatgcga gacatggatc gagcgcggga gtgccatttc accgtattat      1140
     gacccgatga ttgccaaatt gatcgtacac tcttccagcc gtgacgaagc aatcgaagcg      1200
     atgaagagcg cattgagcga gacgacactg tatgggatcg ttaccaatat cggatatttg      1260
     aaaagtgttc tggacgaaga ggtatttgca aaaggggaac agactacgaa atatctgggg      1320
     acgctcaatt attcccctgc tattgtcgaa gtgatcaagc cggggaccca tacgacggtt      1380
     caatccgcac cgggacggat cggttactgg gatatcggtg ttcccccctc gggtcctatg      1440
     gactcactct cgtttcgtct ggggaaccga ctgctaggga acgatgaaaa agcacccggt      1500
     ttggaaatga cggtaacggg ttcgacgctg aagtttcatt ttccgacacg gatcgtgctg      1560
     accggagccg cgatgaaagc tcagctcaac ggagcggaag cggcttattg ggaaaccatc      1620
     gaaatttctg caggcgatat cctgaaaatg gggattatcg aaggagcggg cgcccgtacc      1680
     tatctgctta ttgacggtgg atttgacgtt cccgagtatc tggggagtac ggcgacattt      1740
     acgctgggtg aattcggcgg ccatgcaggg agaatcctgc agatcggcga tcagctcagt      1800
     acccaccgat ccgatgagaa aaaatttcag gcagtcctcg acgccgcatt acgcccgcaa      1860
     atggccaaag agtggaaaat cggggtgatt tacggacctc acggagcacc tgattttttc      1920
     aaagaggagt acattgaaac gttttttgct accgattggg aggtgcacta caactccaac      1980
     cgtaccggag tccggctcat cggtcctaaa ccgctttggg cgcgggagga tggaggagaa      2040
     gcaggattgc atccttccaa tctgcatgat aacgcttatg cgatcggtac ggtcgatttt      2100
     accggtgata tgccggtcat tttaggccct gacggtccca gtctgggagg gtttgtctgc      2160
     ccggtaacga ttgtgggtgc ggagctgtgg aaaatggggc agttaggccc caaagacaga      2220
     gtccgtttca ttccgatgac gtacgatgat gccgttaaga tggaacgtga tttagaagcg      2280
     aagatcgcag gacttgaggg gacattgcca tctctgccgg ctccgaccgt cacgaatccg      2340
     gtggtagcgg aaatcgctgc caacgatcgt catgacgcgg tgaaaatacg gctgtcgggc      2400
     gaccattata tcctgatcga gttcggtccg atggagcttg atctgacatt gcgttttcag      2460
     gttcatgaac tgatgcgccg gctcaaagct gacaatgatg tccgtttgat cgatctcacg      2520
     ccggggatcc gctcattaca gatccattat gagagccaaa cactctcatt gacggaacta      2580
     ttggaaaaag ttaagggaga actttcacga atgccggcaa ctcgggatat catcgttccg      2640
     agccgtacgg tgtatcttcc gttgtcttgg gatgacccct caacgaaact ggcgatcgag      2700
     aaatatatgc agtcggtacg tgacgatgca ccgtggtgcc cgagcaacat cgaattcatc      2760
     cgacggatga acggtttgaa tggcatcgag gatgtccaga atatcctttt tgaagcggaa      2820
     tatctgatca tgggtctcgg ggatgtttat ctgggtgctc cggtagcggt tcccgtcgat      2880
     ccgcgtcacc gtcttgtgac gaccaaatac aatccagccc gtacgtggac accggaaaat      2940
     gcggtaggaa tcggcggaac gtatatgtgt gtttacggga tggaaggacc cggcggatat      3000
     cagttcgtcg gacggacggt acagatgtgg aaccgatata aatcgacaac cgattttaaa      3060
     ctgggcaagc cgtggctatt ggaatttttc gaccgtatcc gattctatcc cgtctcgcag      3120
     aatgaattgg cacaaatgcg aaaagatttc atcaacggga cgttttcatt gcggattgaa      3180
     gagggagaat tctccttggc agagtatctc gagtttttag agacgaacag agaatcgatc      3240
     gatgcattca aaacaatcca gcaagaatcg ttcaacgccg aacgccaacg atgggaggct      3300
     tcagggattt cggcttatgt cagcgaaaca ctcgaaacgg acgatgagag cgatttcgct      3360
     gaaattcctg aggggtgcga agcggtttcg agttttcttt ccggaaatgt atgggaaatt      3420
     tcggttaaag caggggacac agtccgtgag ggggatacgc ttgtgattat cgaagcgatg      3480
     aaatcggaag tgatgatcga gtcacctgtt gcgggggaag tggtcgaagt attatgcgta      3540
     cagggcgata ccgttcatac gggtcatact cttgtcatca ttaaaacaga aggtgtgtaa      3600
//

If you have problems or comments...

PBIL Back to PBIL home page