(data stored in ACNUC7421 zone)

EMBL: CP002355.PE129

CP002355.PE129       Location/Qualifiers
FT   CDS_pept        128556..128897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0130"
FT                   /product="small multidrug resistance protein"
FT                   /note="COGs: COG2076 Membrane transporter of cations and
FT                   cationic drugs; InterPro IPR000390; KEGG: cts:Ctha_1247
FT                   small multidrug resistance protein; PFAM: small multidrug
FT                   resistance protein; SPTR: Small multidrug resistance
FT                   protein; PFAM: Small Multidrug Resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32797"
FT                   /db_xref="GOA:E4TWW6"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW6"
FT                   /protein_id="ADR32797.1"
FT                   /translation="MNSWILLALAILLEVAGTTSMKLSDGMQKIFPTVMIFIFYAMAFV
FT                   LMPFVMKKIEMSTVYAIWTGAGTVMVTVIGIAYFSESSNPIKLASIALIAFGVVGLHFA
FT                   ERSSQGGLG"
     atgaacagct ggattttact ggctctggca attttattag aagttgccgg gacgacatca        60
     atgaaacttt cagacggaat gcaaaagata tttcctacgg tgatgatttt cattttttat       120
     gcgatggcgt ttgtactgat gccgtttgtg atgaaaaaaa ttgagatgag tacggtgtat       180
     gcgatctgga cgggtgcggg gacggtaatg gtgacagtga tagggattgc ctatttcagc       240
     gaatcttcca atccgatcaa actggccagt attgcattga tcgcatttgg agttgttggt       300
     ctgcattttg ccgaacgcag ttcacaagga gggttaggat ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page