(data stored in ACNUC7421 zone)

EMBL: CP002355.PE13

CP002355.PE13        Location/Qualifiers
FT   CDS_pept        14068..15069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0013"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="COGs: COG0226 ABC-type phosphate transport system
FT                   periplasmic component; InterPro IPR005673: IPR006059; KEGG:
FT                   tdn:Suden_1883 periplasmic phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; SPTR:
FT                   Phosphate ABC transporter, phosphate-binding protein PstS;
FT                   TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: Bacterial extracellular
FT                   solute-binding protein; TIGRFAM: phosphate ABC transporter,
FT                   phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32681"
FT                   /db_xref="GOA:E4TW65"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW65"
FT                   /protein_id="ADR32681.1"
FT                   /translation="MLTNVIKGLVIAGVAATSMIAADKINGAGATFPAPVYYDWAYNYQ
FT                   KATKTRVNYQAIGSGGGIKQISERIVDFGATDAPLTQKELDKAKLTQFPAVIGSIVVAH
FT                   NLPGVADEKLKLKNSVVADIFAGKITMWNDPAITADNAGIKLPAEKIIVAHRSDGSGTT
FT                   YVFTDFLSDSSQNWKSKFGIGKAIGWATGVGGKGNEGVTNLIKQTPYSIGYIENAYKEK
FT                   NNLSAATLQTASGKWVTATKANFMAAVKQASWKKSEGFYGSLVSQKGDTAYPIVAATYI
FT                   LLPKEKAEMNDQVIKFFDYAFKNGDKAAEKLGYIPLPVETTNLVREYWAETK"
     atgctaacaa atgtcattaa aggtttggtt atcgctggcg tagcggcaac ttctatgatc        60
     gcagcagaca aaatcaacgg tgcaggtgct acattcccgg ctccggtata ttacgattgg       120
     gcgtataact atcaaaaagc gactaaaaca cgtgttaact atcaagcaat cggatcaggc       180
     ggcggtatca agcaaatctc tgagcgtatc gtagatttcg gtgcaacaga tgctcctttg       240
     acacaaaaag aacttgacaa agcaaaattg actcagtttc ctgcggttat cggttctatc       300
     gttgtagcac ataaccttcc gggtgtagcg gacgaaaaat tgaaacttaa aaactctgtt       360
     gttgctgaca ttttcgccgg taaaattaca atgtggaacg atcctgctat cactgcggac       420
     aatgcgggta tcaagcttcc ggcagaaaaa attatcgttg ctcaccgttc agacggatca       480
     ggaactacct atgtttttac cgatttcttg agtgattcgt cacaaaactg gaaaagcaaa       540
     ttcggtatcg gtaaagcgat cggctgggca accggtgtcg gcggaaaagg gaatgagggt       600
     gtaacaaacc ttatcaaaca aactccgtac tcaatcgggt atatcgaaaa tgcgtataaa       660
     gagaaaaaca acctttcagc cgcaactttg caaacagcaa gcggaaaatg ggtaactgct       720
     actaaagcaa actttatggc agcggttaaa caagcttctt ggaaaaaatc agaaggcttc       780
     tacggatcat tggtatctca aaaaggcgat actgcatatc cgatcgtagc ggcaacgtac       840
     atccttttac cgaaagagaa agcggaaatg aatgaccaag ttatcaaatt ctttgactat       900
     gcgttcaaaa acggcgacaa agcggctgaa aaattgggtt atatcccatt gccggttgaa       960
     acaaccaatc ttgtccgcga atattgggca gaaactaaat aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page