(data stored in ACNUC7421 zone)

EMBL: CP002355.PE130

CP002355.PE130       Location/Qualifiers
FT   CDS_pept        128894..130642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0131"
FT                   /product="allophanate hydrolase"
FT                   /note="COGs: COG0154 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase A subunit and related amidase; InterPro
FT                   IPR013838: IPR014085: IPR000120; KEGG: tgr:Tgr7_3090
FT                   allophanate hydrolase; PFAM: Amidase; SPTR: Allophanate
FT                   hydrolase; TIGRFAM: allophanate hydrolase; PFAM: Amidase;
FT                   TIGRFAM: allophanate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32798"
FT                   /db_xref="GOA:E4TWW7"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW7"
FT                   /protein_id="ADR32798.1"
FT                   /translation="MRELKTIGDYLHQYRVEGRGVREVIQSCLDKSSMFDDKNIWIAKA
FT                   DTSFLEPYFLRLEGCDPASLPLYGVPFAVKDNIDIAGMNTTAGCAEFSYLPSEHAFVVK
FT                   QLIEAGAIPIGKTNLDQFASGLVGTRSPYGEGINLFNPDYVSGGSSSGSALAVTAGIVP
FT                   FSLGTDTAGSGRVPAAFGNIVGLKPTRGALSIRGVVPACKSLDCVAIFAQNCEDAGRVY
FT                   DLCGIVDDEDSFSRSKSCIIPFGGTFRFGVPREEQLEFFGNSAYESLFWESVKKLESLG
FT                   GIRCEIDFSPFIETAKLLYHGPWIAERYCGIKSFADTQSDAMLDVTRGIILSGAKPSAM
FT                   DAFEGFYRLSELKKISDRIMDSVDMIMTPTAGTIYRRDEIREQPLALNTNLGYYTNFMN
FT                   LLDLSACAVPAGFTSEGLPFGVTLAAPAWYEHSLLNVGAKLHAASGYESGLIEPHQPKT
FT                   VVLAVCGAHMSGLPLNHELTDRGARLVEKSSTAPQYRFFALENFTPPRPGLVQVNEGGG
FT                   TIEVELWEIPSEEFGSFFSGVPSPLALGSLILADGKVVKGFLCESYAVEGAKEITALGG
FT                   WRNYLQ"
     atgagagagt tgaaaacgat aggtgattat ctgcatcagt atcgggtaga aggtcgtggc        60
     gtcagagaag taattcagag ttgtcttgac aaatcgagta tgtttgatga taaaaacatt       120
     tggattgcca aagcggatac atcatttctg gaaccgtatt tcctccgttt ggaagggtgt       180
     gatcctgcct cattgccgct atacggagtt ccgtttgcgg taaaagacaa catcgatatt       240
     gcagggatga acacaacggc cggatgtgcg gaattttcct atcttccgag cgaacatgcg       300
     tttgtggtca aacagctgat tgaagccggt gcgattccga tcggcaagac caatctggac       360
     cagtttgcgt cagggcttgt cgggacacga agcccttatg gagaggggat taatctattt       420
     aatcccgatt acgtctccgg agggtcgagt tcagggtcag cattggccgt gactgcgggg       480
     atcgtccctt tttcgctggg aaccgatacg gcaggatcgg gccgcgttcc tgccgcgttc       540
     ggaaacatcg tcgggttaaa accgacacgg ggggcattga gtatccgagg ggttgtcccc       600
     gcatgcaaaa gtctcgattg tgtcgccatt tttgcccaaa actgcgaaga tgccggacgt       660
     gtttatgacc tgtgcggcat cgttgatgat gaggactcct tttcacgttc gaaaagttgc       720
     attattccgt tcggagggac gtttcgtttc ggggtaccga gagaagagca actggaattt       780
     ttcggaaaca gtgcgtacga atccctgttt tgggagagtg ttaaaaaact cgagtcgtta       840
     ggggggatcc gatgcgagat tgatttttcc ccttttatcg agacggcaaa actgctctac       900
     cacggaccgt ggattgccga acgctactgc gggattaaat ccttcgccga tacgcagagc       960
     gacgcaatgc tggacgtgac ccgagggatt atcctctccg gtgccaaacc gagcgctatg      1020
     gatgcgtttg aagggtttta ccgcctctct gagctcaaaa aaatcagcga ccggattatg      1080
     gactcggtcg atatgatcat gacgcctacg gccgggacaa tctaccgtcg tgatgaaatt      1140
     cgtgaacagc cgctcgcgtt gaatacgaat ctcggctatt acaccaattt tatgaatctg      1200
     cttgatctga gcgcatgcgc cgttcctgcc ggatttacct ctgaggggct gccgtttggg      1260
     gtgacccttg ccgcaccggc ctggtatgaa cattctcttt taaatgtcgg agcaaaattg      1320
     catgctgcat cagggtatga aagcggtctt attgaaccgc accaaccgaa aacggttgtt      1380
     ttagccgttt gcggggcgca tatgtccggt cttcccctga atcatgaatt aaccgacaga      1440
     ggggcacggc tggttgaaaa atcttcaacc gccccgcagt accgcttttt tgctctggaa      1500
     aactttaccc ctccgcgtcc ggggcttgtc caggtgaatg aaggcggcgg cacaattgaa      1560
     gttgaacttt gggagattcc tagcgaagag ttcggatcgt tttttagcgg agttccctca      1620
     ccattggctc tggggagcct gatattggcc gatggcaaag tagtcaaagg atttctttgc      1680
     gagagttacg cagttgaggg ggcaaaagag atcactgcct taggcggatg gagaaattat      1740
     ttacaataa                                                              1749
//

If you have problems or comments...

PBIL Back to PBIL home page