(data stored in ACNUC7421 zone)

EMBL: CP002355.PE131

CP002355.PE131       Location/Qualifiers
FT   CDS_pept        complement(130823..132040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1487 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32799"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW8"
FT                   /protein_id="ADR32799.1"
FT                   /translation="MRVTKISLLASLLLYTSSFAVDNIEVSGAGKFFYGTVDGSPDGTS
FT                   RPNLFNKEGAFAQFGIDMGIAADLGAGFKGKIAGTGLATANMGGNIVNAPWATGMMGSQ
FT                   VWLSEVYLNKNVLDKTAVTLGRQSLDTPFAFTELWNIAANTFDAVLVENTDLSDTTLIG
FT                   AYIDKGNGVNGFATVNPAIADSGKLKNPFKKFYEGAYVVGAKNKSFNGTELQAWFYELK
FT                   NTAKSYWIQGDTEFSGITLGAQAAVLNLDNTLDSSDNSKAYAAKIGYTAIENLTLSAAV
FT                   SQTDKDGSANFQIANLATGGSGGAQSKLYTEAWWNFGYVGKAGTTAYNVTALYTVPEIV
FT                   DLGFFYTDVDQRAANGDNDMREYTLTAAKSFGSLDTSLAYVYSKANDYNDAKYYNNIQV
FT                   YLTYKF"
     atgagagtta caaaaatcag tttattggcg tcattgttat tatatacgtc atcttttgct        60
     gtcgacaaca tagaagtttc aggtgccggc aaattctttt acggcactgt cgatggatcg       120
     cctgatggga ctagccgtcc taaccttttt aacaaagaag gggcattcgc tcaattcggg       180
     attgatatgg gcatcgctgc cgatctggga gccggattca aaggaaaaat tgccggtacc       240
     ggattagcca ctgccaatat gggcggcaat atcgtcaatg caccgtgggc gaccgggatg       300
     atgggaagcc aggtctggct aagcgaagtt tatttaaata aaaacgtatt ggataaaaca       360
     gccgtaactc ttgggcgcca gagtcttgac accccttttg cttttaccga actttggaat       420
     atcgcggcta atacttttga tgctgtttta gttgaaaaca ccgatttatc ggatacgaca       480
     cttatcggag cctatatcga caaaggtaac ggcgttaacg gatttgcaac ggtcaatccg       540
     gctattgcag attcaggaaa attaaaaaat ccgttcaaga agttttatga aggggcctat       600
     gtcgtagggg cgaaaaacaa atcgtttaac ggcactgaac tgcaagcatg gttctatgaa       660
     ctaaaaaata cggctaaatc gtactggatt cagggcgaca cagaattttc cggaataacg       720
     ttaggagctc aggcggcagt gttgaatttg gataatacgc ttgactcgtc tgacaattct       780
     aaagcttatg cagctaaaat cggatacacc gcgattgaaa acctcacgct aagcgccgcc       840
     gtttcccaaa cggataaaga cggatcggca aactttcaaa tcgctaattt ggctaccggc       900
     gggagcggcg gagcgcaatc aaaactctac accgaagcat ggtggaactt cggatatgtc       960
     ggcaaagcgg gtacgaccgc ctataatgtc accgctcttt atactgttcc tgaaatcgta      1020
     gatcttggat tcttttatac ggatgtagat cagcgtgcgg caaacggcga taacgatatg      1080
     cgcgaatata ccctaaccgc tgctaaatct ttcggttcgc tcgacacaag cctcgcttac      1140
     gtctactcta aagccaatga ttataacgat gccaaatatt acaataacat ccaagtttat      1200
     ctaacgtata aattttaa                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page