(data stored in ACNUC7421 zone)

EMBL: CP002355.PE132

CP002355.PE132       Location/Qualifiers
FT   CDS_pept        133180..134520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0133"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG1113 Gamma-aminobutyrate permease and
FT                   related permease; InterPro IPR002293: IPR004841; KEGG:
FT                   hth:HTH_0635 amino acid permease; PFAM: amino acid
FT                   permease-associated region; SPTR: Amino acid permease;
FT                   PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32800"
FT                   /db_xref="GOA:E4TXA3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA3"
FT                   /protein_id="ADR32800.1"
FT                   /translation="MSGTNGEFRRSLGLMDVTFIGVGAVIGAGIFVITGQAAATMAGPA
FT                   IVLSFLLGAVMIGITALIYAELSSAYPVAGSAYSFTFASLGEVFAWFVGWNLLLEYGVA
FT                   TAAVATGWSGYLRRFLENSMGLHIPQALSGAYNPSAGTYIDISAFGIILAIFVLLAIGI
FT                   KESAKVNTAIVFIKLGVLVTFVVVGLPHVDFHNLSNFFPFGWEGVWHGASLIIFAYLGF
FT                   DAISTVAEETKNPERNIPLGLILSLALSVVFFILVSFTLTAIVPYQELNVPDALAFALY
FT                   KVNEPFAANVIALGAVITITTVMIVMGLGFTRIFFALARDGLLPKTLSEIHPKFNTPYK
FT                   ATIIGGILLSIMAGLIPLKTLAELVNIGTLFAYLMVAVAIIVLRRQNSIQPVFKIPAFK
FT                   ILMPLNFILIIFMMAGLPFETWLRFIGWSVIGMLIYAYYSTKRSKAE"
     atgagcggca caaacggaga attccgtcga agcctcggtc tcatggatgt aacgtttatc        60
     ggtgttggtg cggttatcgg cgccggtatc ttcgttatca ccggtcaggc ggcggcaacg       120
     atggcgggac cggcgatcgt attgtcgttc ttgctcggtg ccgtgatgat cgggattacg       180
     gctcttatat atgcggaact cagctccgcc tatccggttg cggggagtgc gtacagtttt       240
     acatttgctt ctttggggga agtatttgcg tggtttgtgg gatggaatct gctccttgaa       300
     tacggagtgg ctactgccgc ggtggctacg gggtggtccg ggtatctgcg ccgtttcttg       360
     gaaaactcta tgggactaca tatcccgcaa gccctcagcg gcgcttataa cccgagtgca       420
     gggacttata tcgatatcag tgcattcggg attattttgg ctatttttgt tcttctggca       480
     atcggtatca aggagagtgc aaaagttaat acggccatcg tatttattaa gcttggagtt       540
     ttagtaacat tcgtggtagt aggattgccg cacgttgatt ttcataatct ctccaacttt       600
     ttcccgttcg gatgggaagg ggtatggcac ggagcttcat tgattatttt tgcttacctc       660
     ggatttgatg cgatcagtac ggtagctgaa gagacgaaaa accctgaacg caatatcccg       720
     ttgggactta tcctctcctt ggctttgagt gtcgtctttt ttatcctggt gagttttacc       780
     cttactgcaa tcgtaccgta tcaggaactg aacgttcccg atgcgcttgc ttttgcattg       840
     tacaaagtaa atgaaccgtt tgcggcaaac gttatcgctt tgggtgccgt tattacgatt       900
     acgacggtta tgatcgttat ggggctcggg tttacccgta tcttttttgc ccttgcacgc       960
     gacgggctat tgccgaagac actaagtgaa attcatccga aattcaatac tccctataaa      1020
     gcgactatta tcggcggtat cttgctcagt attatggcag ggttgatccc tcttaaaacg      1080
     ttggcggaat tggtcaatat cggaacactg ttcgcctatt tgatggtagc ggtggcgatt      1140
     atcgttcttc gtcgccaaaa tagtattcag ccggtcttta aaatccctgc gtttaaaatc      1200
     ctgatgcccc ttaatttcat tctgattata tttatgatgg cggggttgcc gtttgagaca      1260
     tggcttcgct ttatcggatg gtcggttatc gggatgttga tttacgctta ttacagtacg      1320
     aaacgttcaa aggcagagtg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page