(data stored in ACNUC7421 zone)

EMBL: CP002355.PE134

CP002355.PE134       Location/Qualifiers
FT   CDS_pept        complement(135992..136768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0135"
FT                   /product="thiazole-phosphate synthase"
FT                   /note="COGs: COG2022 Uncharacterized protein of thiazole
FT                   biosynthesis; InterPro IPR008867; KEGG: tdn:Suden_0217
FT                   thiazole synthase; PFAM: thiazole biosynthesis family
FT                   protein; SPTR: Thiazole synthase; PFAM: Thiazole
FT                   biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32802"
FT                   /db_xref="GOA:E4TXA5"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA5"
FT                   /protein_id="ADR32802.1"
FT                   /translation="MHTLQIGKYTLGSRLIVGSGKYDSFETTKAATLASGSELITVAVR
FT                   RLNITNPNEPNLRDTFAGTNVKFLPNSAGCTTAEEAITLFRLTREATGIDLIKLEVIGD
FT                   TQKTLYPDVLETIKACEVLAKDGFTIMAYTSDDPIMARRLEDAGAHAIMPLAAPIGSGL
FT                   GVQNKYNIVFVREAVKVPIIVDAGIGCASDAALAMELGADGVLTNTAIAQAQNPILMAE
FT                   AMKNAVIAGRLSYLAGRIPKRPYATASSPVDGMIQF"
     atgcatacat tacaaatcgg aaaatatact ctcggaagcc gactcatcgt cggaagcggt        60
     aaatacgact cgtttgaaac aaccaaagcg gcaactttgg cctcgggttc tgagctgatc       120
     accgtcgccg tacgccgttt gaacatcacc aatccgaatg agccgaatct ccgtgatacc       180
     tttgcgggaa cgaacgtcaa gtttctgcca aactctgccg gatgtacgac agccgaagag       240
     gcgattaccc ttttccgtct tacccgcgaa gcgacgggga tcgatttgat caaactcgaa       300
     gtaatcggcg atacccaaaa aactctctac cccgatgttt tggagacgat caaagcgtgt       360
     gaagtgttag ccaaagacgg ttttactatt atggcgtata cctcggatga tccgattatg       420
     gcacgccgat tggaagatgc gggtgcccat gcgatcatgc cgctcgccgc tccgatcgga       480
     tcaggtctcg gcgttcaaaa caaatataac atcgtgtttg tccgtgaagc ggtcaaagtg       540
     ccgattatcg ttgatgcggg aatcggatgt gcgagtgatg ctgcgttagc gatggaactc       600
     ggagcggacg gagttttgac gaacaccgcg attgcgcagg cgcaaaatcc gatactgatg       660
     gcggaagcta tgaagaatgc tgtaattgca ggacgtttaa gctatcttgc gggacgcatc       720
     ccgaaacgtc cgtatgcgac cgcaagctca ccggttgatg ggatgattca gttttaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page