(data stored in ACNUC7421 zone)

EMBL: CP002355.PE135

CP002355.PE135       Location/Qualifiers
FT   CDS_pept        complement(136783..137337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0136"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="COGs: COG0299 Folate-dependent
FT                   phosphoribosylglycinamide formyltransferase PurN; InterPro
FT                   IPR004607: IPR002376; KEGG: nis:NIS_0171
FT                   phosphoribosylglycinamide formyltransferase; PFAM: formyl
FT                   transferase domain protein; SPTR: Phosphoribosylglycinamide
FT                   formyltransferase; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: Formyl transferase; TIGRFAM:
FT                   phosphoribosylglycinamide formyltransferase,
FT                   formyltetrahydrofolate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32803"
FT                   /db_xref="GOA:E4TXA6"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA6"
FT                   /protein_id="ADR32803.1"
FT                   /translation="MKKIVALFSGEGTNLANLITKIHLKHAAIVCAITNNPEAGGIAKA
FT                   RSAGIPVEILDHRDFESRELYDEALVSLIQEYNPDLVVLCGFMRILTPVFTSQIRSINL
FT                   HPALLPAFKGARAIERSFESDEKVCGVSVHWVTDELDGGEIILQKSFTKNPNDNLEEFT
FT                   AKIRAIEHEVLPLSILKVLHD"
     atgaaaaaaa tcgttgccct ctttagcggc gaggggacca acctcgccaa tctgatcaca        60
     aaaatccatc ttaagcatgc cgcaatcgtt tgtgctatca ccaataatcc cgaagcggga       120
     ggtattgcca aagccagaag tgccggcata ccggtcgaga tacttgacca ccgggatttt       180
     gagagtcgcg aactctacga tgaagcgttg gtttcactca tccaagagta caatcccgat       240
     ctcgtagtgc tgtgcgggtt tatgcggatt cttacccccg tatttacatc gcagatccgt       300
     tccataaacc tccatcccgc acttctccct gcgttcaaag gtgcccgggc aatcgaacgc       360
     agcttcgaaa gcgatgaaaa agtatgcgga gtcagtgtac actgggtcac cgatgaacta       420
     gacggcggtg aaataatctt gcaaaaaagt tttactaaaa atcctaatga taatttagaa       480
     gaatttactg ctaaaattcg cgcaatcgag catgaggttc tccctctgag catactaaaa       540
     gttttacatg actaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page