(data stored in ACNUC7421 zone)

EMBL: CP002355.PE136

CP002355.PE136       Location/Qualifiers
FT   CDS_pept        complement(137334..138725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0137"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="COGs: COG0063 sugar kinase; InterPro IPR017953:
FT                   IPR004443: IPR000631; KEGG: nis:NIS_0170 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0031;
FT                   YjeF-family domain-containing protein; SPTR: Putative
FT                   uncharacterized protein; TIGRFAM: carbohydrate kinase, YjeF
FT                   related protein; PFAM: Carbohydrate kinase; YjeF-related
FT                   protein N-terminus; TIGRFAM: yjeF N-terminal region; yjeF
FT                   C-terminal region, hydroxyethylthiazole kinase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32804"
FT                   /db_xref="GOA:E4TXA7"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA7"
FT                   /protein_id="ADR32804.1"
FT                   /translation="MQNLYLDVSPLDQRGVTKFALSEEVMMEHAAMAMAHLIRARFNAN
FT                   SSVLIVCGSGNNGADGLALARLLEGDFHISLHIPFGASSPLAHLQRDRVEALGLKHAPI
FT                   EGDYDVIVDALFGSGLNRPLGPTAIEALILMNGMSGLKIACDVPSGLYAEGTFDTNVFY
FT                   ADITVTMGAYKRSLFSDGAKEVCGEIIVADLGVHKKRYETPSPWKLLESQDLSLPNRIR
FT                   ASSHKGSYGHLAVVCGEKAGASVIAGSAALRFGTGLVSLISNENVTIPYELMQSHSIPS
FT                   TATAIALGMGLGVEFCDDELSSLLDNTLPLVLDADIFYHPMFSKLLKRTSLVLTPHPKE
FT                   FTQILRLTGIADIDVSALQSNRFTYVEKFCSAYPNTVLVLKGSNVIIGQGEEFYINPLG
FT                   TVALAKGGSGDVLSGLIGALLAQGNTPLEAAIQGSLAHTLAAQKFDKNNYALTPFDLIE
FT                   RITCL"
     atgcaaaatc tttaccttga cgtatcacct cttgatcagc gcggcgttac gaaatttgcc        60
     ctcagtgaag aggtgatgat ggaacatgcc gcaatggcga tggcacactt gatccgagcg       120
     cggtttaacg ccaattcatc cgttctcatt gtctgcggca gcggaaacaa cggagcggac       180
     ggcttagccc tagcaaggct tctggaaggg gattttcata tctctctcca tattcctttc       240
     ggtgcgagtt cgccgcttgc ccatcttcag cgggatcgcg tcgaagcgtt aggattaaaa       300
     catgctccta tcgaaggaga ctatgacgtt atcgttgatg cacttttcgg ttcagggttg       360
     aaccgtcctc tcggcccgac ggctatcgaa gctttgatct tgatgaatgg gatgagcgga       420
     ctcaaaatag cgtgtgacgt ccccagcggc ctttacgccg agggcacatt cgatactaat       480
     gttttttatg ccgatatcac ggtcacgatg ggggcttata aacgttcgct tttcagcgac       540
     ggcgccaaag aggtctgcgg cgaaatcatc gttgcggatt taggagtaca taaaaagcga       600
     tatgagacac cgtcgccatg gaagttatta gaatctcagg acttatcact cccaaacaga       660
     atccgagcct cttcccataa aggaagctac ggccatttgg cggtagtctg cggcgaaaaa       720
     gcaggcgcat ccgtaatcgc aggctcagca gccctccgtt tcggaacggg attggtgagt       780
     ctgatcagta acgaaaacgt aaccatccct tatgagctga tgcaaagcca ttccattccc       840
     tcaacggcca cggctattgc actggggatg gggctggggg tagagttttg cgacgatgag       900
     ctctcctctt tgctggacaa tacccttccg ctggttttgg atgccgatat tttttaccat       960
     ccgatgttta gcaaactttt aaaacgcacc tcgctcgtcc ttaccccgca tcccaaagag      1020
     ttcacccaaa ttttacggct caccggtatc gccgatatcg atgttagcgc attgcaaagc      1080
     aaccgtttca cttacgttga gaaattttgc tccgcctatc caaacacggt gttagtgctt      1140
     aaaggctcca acgttattat cgggcaggga gaagagtttt atatcaaccc gctgggaacc      1200
     gtagctcttg ccaagggggg aagcggggat gtcctaagcg gtcttatcgg tgccctgctg      1260
     gcacaaggga atacgccgtt ggaagcggca attcaaggtt cgctcgcaca taccctcgct      1320
     gcacagaaat tcgataaaaa caattatgcc ctcaccccat ttgacctcat agaaagaatt      1380
     acctgcttat ga                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page