(data stored in ACNUC7421 zone)

EMBL: CP002355.PE137

CP002355.PE137       Location/Qualifiers
FT   CDS_pept        138770..139738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0138"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="COGs: COG0794 sugar phosphate isomerase involved in
FT                   capsule formation; InterPro IPR004800: IPR000644:
FT                   IPR001347; KEGG: nis:NIS_0063 arabinose-5-phosphate
FT                   isomerase; PFAM: sugar isomerase (SIS); CBS domain
FT                   containing protein; PRIAM: Arabinose-5-phosphate isomerase;
FT                   SMART: CBS domain containing protein; SPTR:
FT                   Arabinose-5-phosphate isomerase; TIGRFAM: KpsF/GutQ family
FT                   protein; PFAM: CBS domain; SIS domain; TIGRFAM: KpsF/GutQ
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32805"
FT                   /db_xref="GOA:E4TXA8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA8"
FT                   /protein_id="ADR32805.1"
FT                   /translation="MNNDYIAIAKNTLEIEAQALREGSERLGEEIARAVEIILSCKGKL
FT                   VITGVGKSGLIGAKIAATFASTGTPSFFLHPTEALHGDLGMIGREDAVLAISYSGESPE
FT                   LSSILPHIKRFDIPLIGMTRNAASTLGRYSDEVININVEHEACPLDIAPTSSTTLTLAM
FT                   GDALAVCLMKARNFQKEDFASFHPGGALGKRLFVKVSDLMRTENLPIVNENTPLKEAIL
FT                   ILSEGRLGTVMLTNNEGKLSGLLSDGDIRRALMSESFSLDASAKAYATKKPLVIDDASM
FT                   LASDALVLIETKKIQLLVVTDRAGVIQGALHLHTLVEAGIS"
     atgaacaacg attatatcgc aatagccaaa aacacacttg aaattgaagc gcaagctctc        60
     cgtgaaggat ctgaacggct cggagaagag atagcgcgtg cggtagagat tattctctca       120
     tgcaaaggaa aattggttat aacgggtgtc ggaaaatcgg gactgatcgg ggctaaaata       180
     gccgcaacgt ttgcctctac cgggacaccg agctttttcc tccatccgac cgaagcgcta       240
     cacggcgatt tagggatgat aggacgtgag gatgcggtac tggcgatcag ttacagcggc       300
     gagagtcctg aactcagttc tattcttccg cacatcaagc gtttcgatat ccctttgatc       360
     gggatgacgc gcaatgccgc ttcgacactc ggacgttaca gtgatgaagt gatcaatatc       420
     aatgttgaac acgaagcgtg cccgctggat atcgctccga ccagttcaac gacgctgaca       480
     ttggccatgg gggacgcgtt ggcggtatgt ttgatgaagg cacggaattt tcaaaaagag       540
     gattttgcct ctttccatcc cggcggtgca ttgggcaaac gcctttttgt taaagtaagt       600
     gatctgatgc ggacggagaa ccttccgatc gtcaatgaaa acactccgtt gaaagaggcg       660
     attctcatcc tcagcgaagg acgattggga accgtgatgc tcacaaacaa tgaaggaaaa       720
     ctttcaggtc ttttgagtga cggcgatatt cgccgtgcgt tgatgagcga atcgttttct       780
     ctcgatgcct ccgccaaggc gtatgcaacc aaaaaacccc ttgtaatcga tgatgcgtcg       840
     atgcttgcca gtgatgcgct ggtattgatc gagacgaaaa aaatccagtt gctggtggtc       900
     accgaccgag ccggcgttat tcaaggtgca ttgcatcttc atacactcgt ggaagcaggt       960
     atctcatga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page