(data stored in ACNUC7421 zone)

EMBL: CP002355.PE139

CP002355.PE139       Location/Qualifiers
FT   CDS_pept        140679..141077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0140"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="COGs: COG0432 conserved hypothetical protein;
FT                   InterPro IPR001602; KEGG: nis:NIS_0065 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0047; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family UPF0047; TIGRFAM: secondary
FT                   thiamine-phosphate synthase enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32807"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB0"
FT                   /protein_id="ADR32807.1"
FT                   /translation="MKTLKFPTSHKTQLMDISAEVREAVIMSGIKEGICVVFTPHTTGS
FT                   IFLFENADQNLRRDLLSALSKVIPSDAQYAHVGSNAAAHLKSSRMGASVSIPVHEGRPM
FT                   FGKWQGVFFGEFDGPRQEREVIIKVIAG"
     atgaaaacac tcaaatttcc aaccagtcat aaaacacagt taatggatat tagtgcagaa        60
     gtgagagaag cggtcattat gtcgggtatt aaagagggta tttgtgtcgt gttcactccg       120
     catacgacag gaagcatctt tttattcgaa aatgcagacc aaaatcttcg ccgtgattta       180
     ttgtcagctc tttccaaagt cattccgagt gatgcgcaat acgctcatgt cggaagcaat       240
     gcggcagccc atctaaaatc atcccgtatg ggtgcatcgg ttagcatccc cgtacatgag       300
     gggcgtccga tgttcggaaa atggcagggt gttttcttcg gtgaatttga cggaccgcgt       360
     caagaacgtg aagtgattat caaagtaata gcaggttaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page